KEGG   Alkalitalea saponilacus: CDL62_11020Help
Entry
CDL62_11020       CDS       T04906                                 

Gene name
pruA
Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00250  Alanine, aspartate and glutamate metabolism
asx00330  Arginine and proline metabolism
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDL62_11020 (pruA)
   00330 Arginine and proline metabolism
    CDL62_11020 (pruA)
Enzymes [BR:asx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CDL62_11020 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASB49633
UniProt: A0A1T5BPE0
Position
complement(2829633..2831264)
Genome map
AA seq 543 aa AA seqDB search
MSKGFFKIPTTKNEPVLNYLPGSPERAALKEQIAQYKSSEMDIPMFIGGEEVRSGNTVRI
FPPHEIEHTLGHYHAGDETHVYRAIDAATNAKEGWEALNWEERAAIFLKAADLISGPYRQ
KLNASTMLGQSKNVYQAEIDAACEMADFLRFNVHYMTAIYNDQPASSPGIWNRMEYRPLE
GFVFALTPFNFTSIAGNLPSAPAMMGNVVIWKPSKTAIYSAHILMELFREAGLPDGVINL
IFAPGPVVARAVFDHPDFAGFHFTGSTGVFQDIWKTIGNNIHKYKSYPRIVGETGGKDFI
IAHKSCDAQAVATALIRGAFEYQGQKCSAVSRAYLPSGRWDEILSYLQKDMKEIKMGSPE
DFRNFMNAVIDEPSFDKLASEIDAAKNHPDTKIIFGGNYDKTHGYFIEPTIILTTNPSYK
TMEEELFGPILTIYVYDDSKLDETLNVLDKTSMYALTGAVFAKDRAIIQKITKRLSNAAG
NFYVNDKPTGAVVGQQPFGGARGSGTNDKAGSMLNMLRWVSPRTIKENFVPPVDFKYPFM
MEE
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggattctttaaaattccaacaaccaaaaatgaaccggtactaaactactta
cccggatcacctgagagagcagcactaaaagaacagatagcacaatacaaatcatcagaa
atggacatacccatgttcattggaggtgaagaggtgcgctctggaaataccgtaagaata
ttcccgcctcatgaaatcgaacacactttgggtcactaccatgcaggcgacgagacacac
gtttaccgtgccattgacgcagccaccaacgcgaaagaaggctgggaggcactgaactgg
gaagaacgggcagccatatttcttaaagcggccgacttaatatccggaccataccgtcag
aagttaaacgcctcgaccatgttgggtcaatcaaaaaatgtttaccaggctgaaatcgac
gccgcatgtgaaatggcagattttctgagattcaatgtgcattacatgacggccatatac
aacgatcaacccgcttcctctccgggaatttggaatcgcatggaataccggccattggaa
gggtttgtgtttgcattaaccccattcaattttacatccattgccggcaacctgccttcg
gctccggctatgatgggcaatgtggtgatttggaaaccatcaaaaacagccatatactct
gcacatatacttatggagctgtttcgggaagccggtctcccggacggtgttattaacctt
atatttgctcccggaccggtggtggcaagagccgtttttgatcatcccgattttgcaggg
ttccattttacaggttccaccggggtatttcaggatatatggaaaaccattggtaacaac
atccataaatataaatcttaccccagaatagttggcgaaacaggtggtaaagatttcatc
attgcacataaaagctgtgatgcacaagcagttgccactgccctgataagaggtgcgttt
gagtatcaagggcaaaaatgctctgccgtttcaagagcttatttgccatcaggcagatgg
gatgagatattaagctaccttcaaaaagatatgaaggagattaaaatgggatctcccgag
gattttagaaatttcatgaatgcggtgattgatgaaccctcttttgacaaactggcttca
gaaatcgatgcagccaaaaatcatccggatacaaaaatcatctttggaggaaactacgat
aaaacccatgggtattttattgagcccaccatcatacttaccaccaatccttcctataaa
acaatggaggaggagcttttcggcccaattttaaccatttatgtgtatgatgactcaaaa
cttgatgaaacactaaatgttctggataaaacatctatgtatgcactaaccggggccgtt
tttgcaaaggatcgcgcaatcattcaaaaaataacaaagaggttatccaacgcagccggc
aatttctatgtgaacgacaaaccaaccggggcggtggttggtcaacagccatttggcggc
gcacgtgggtcaggaaccaatgataaagccggttcaatgctgaacatgttgcgatgggtg
tccccaagaaccataaaagagaacttcgtgcctccggttgatttcaagtatccgtttatg
atggaagagtaa

DBGET integrated database retrieval system