KEGG   Alkalitalea saponilacus: CDL62_18420Help
Entry
CDL62_18420       CDS       T04906                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00480  Glutathione metabolism
asx00590  Arachidonic acid metabolism
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CDL62_18420
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDL62_18420
Enzymes [BR:asx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CDL62_18420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ASB50981
UniProt: A0A1T5HTD5
Position
complement(4766666..4767214)
Genome map
AA seq 182 aa AA seqDB search
MRNKVIQFGAFLWLAAISMSASAQSGFYSFEVNTLGGTPFSFSSLKGKKVMVVNTASECG
LTPQYEQLQALWEQYGGDDFVIIGFPANDFMNQEPGSAEEIMEFCQINYGVTFPMMEKIT
VVGDDKHPLYQWLTQKSLNGFKDSEVQWNFQKYLIDKNGKLVKVVPPRTRPDDPEVVAWI
QK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaataaggtaattcaatttggggcatttctatggctggctgccatctcaatgtcg
gcaagcgcacaatccggtttttactcatttgaagtaaatactcttggaggaactcctttt
agtttttcatctctgaaaggtaaaaaggtgatggtggttaatactgcaagtgaatgcgga
ctgactcctcagtacgaacagcttcaggctctgtgggagcaatacgggggagatgatttt
gtgattattggttttcctgccaatgattttatgaatcaggaacccgggagtgcggaggag
atcatggaattttgccaaatcaattatggggtgacctttcccatgatggaaaaaataaca
gtggttggtgatgataaacaccctctttatcaatggctgactcagaaatctcttaacggt
tttaaggatagtgaggtgcagtggaactttcaaaaatacctgattgacaaaaacgggaaa
cttgtgaaagtggtaccacccagaaccagaccggatgatccggaggtggtggcgtggatt
caaaagtag

DBGET integrated database retrieval system