KEGG   Candidatus Arsenophonus lipoptenae: AUT07_00303Help
Entry
AUT07_00303       CDS       T04248                                 

Gene name
metG
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
asy  Candidatus Arsenophonus lipoptenae
Pathway
asy00450  Selenocompound metabolism
asy00970  Aminoacyl-tRNA biosynthesis
asy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AUT07_00303 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUT07_00303 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asy01007]
    AUT07_00303 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asy03016]
    AUT07_00303 (metG)
Enzymes [BR:asy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AUT07_00303 (metG)
Amino acid related enzymes [BR:asy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AUT07_00303 (metG)
Transfer RNA biogenesis [BR:asy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AUT07_00303 (metG)
 Prokaryotic type
   Other AARSs
    AUT07_00303 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AMA64885
UniProt: A0A0X9VIT3
Position
362833..364503
Genome map
AA seq 556 aa AA seqDB search
MNITAKKILVTCALPYANGAIHLGHMLEHIQADIWVRYQRMRGKQVFFICADDAHGTPIM
LKANQLGINPEKLISKINKEHQKDLAEFSISYDNYYSTHSIENQMLSEQIYLILKKNGFI
KSKTILQFYDPQKMMFLPDRFVIGICRKCKASNQYGDHCEICGATYNPMELVNPRSVISG
ATPEMRETKHFFFDLPVFYNMLKKWTLSGILQLPVVNKLQEWFKTGLKQWDITRDAPYFG
FEIPNEPKKYFYVWLDAPIGYIGTFKNLCKKKPNIDFDSYWNKNSTVALYHFIGKDITYF
HILFWPAILEGIGYRKPTNIFVHGYITINGMKMSKSKGTFITARDYLDHLDSDCLRYYYA
TKLSSSIDDIDLNLKDFVQKVNSDIVNKIVNLAARNAGFINKQFNNKLSSNIAEPELYQK
FITASKKIGQLFCNREYNKATNKIILLANIANHYIDDKKPWIIAKQTGCENILHNVCSMG
INLFRIIMTYLKPILPGLIDKTEMFLNISLEWDDIKKPLLNHEITPFKTLFKRIDINKIS
FMLEKSNKNITADKNN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaccgcgaaaaaaattttagtaacttgtgcattaccttatgctaatggtgca
attcacttaggacatatgttagaacatattcaggcagatatttgggttcgttatcaacga
atgagaggcaagcaagttttttttatctgtgctgatgatgctcatggtacaccaataatg
ttaaaagctaatcaattaggtataaatcctgaaaaattaattagtaaaatcaataaagaa
caccaaaaagatcttgctgagttttcaattagttatgataattattattcaactcatagt
atagaaaatcagatgttatctgaacaaatttatttaattttaaaaaagaatggttttatt
aaaagtaaaactattttacaattttatgatcctcaaaaaatgatgtttttgcctgatcgc
tttgttataggaatttgtcgaaaatgtaaagcaagtaatcaatatggagatcattgtgaa
atttgtggagcaacttataatcctatggaactagtaaatccacgatcagtaatttcgggt
gccacacctgagatgcgggaaacaaagcattttttctttgatttaccagtattttacaat
atgctaaaaaaatggacactatcaggtatattacaattgccagtagtaaataagttacag
gaatggtttaaaacaggtttaaagcaatgggatattactcgtgatgcaccttattttggt
tttgaaataccaaatgaacctaaaaaatatttttatgtgtggctagatgcacctattggt
tacataggaacattcaaaaacctatgtaaaaaaaaacctaatatagattttgatagttat
tggaataaaaattccactgtagctctttaccattttattggcaaagatattacatatttt
catattctattttggccagcaatattggaaggtataggttatcgtaaacctactaatatt
tttgttcatggttatataaccataaatgggatgaaaatgtccaaatcaaagggcactttt
attacagctagagattatttggatcatcttgatagcgattgtttacgttactattatgct
actaaactttcttctagtattgatgatattgatcttaacttaaaagattttgttcaaaaa
gtaaatagtgatattgttaataaaatagttaatttagcagcaagaaatgctggatttatc
aataaacaatttaataataaattatcatctaatatagcagaaccagaactttatcaaaaa
tttattactgcatcaaaaaaaattggtcaattattttgtaatcgtgaatataataaagcg
accaataaaattatattgcttgctaatatagctaatcattatattgatgataagaaacca
tggataatagccaaacaaacgggatgtgaaaatattttacataacgtatgttccatgggc
atcaatttatttcgtattatcatgacatatttaaaacctatattacctggacttattgat
aaaacagagatgtttttaaatatttcactagagtgggatgatatcaaaaaacctttatta
aatcatgaaattacaccatttaaaactctattcaaaagaatagatataaataaaatatca
tttatgttagaaaaatctaataaaaatataaccgccgataaaaataattga

DBGET integrated database retrieval system