KEGG   Agrobacterium tumefaciens S33: AWN88_14555Help
Entry
AWN88_14555       CDS       T04213                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00471  D-Glutamine and D-glutamate metabolism
ata01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AWN88_14555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ata01011]
    AWN88_14555
Enzymes [BR:ata01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AWN88_14555
Peptidoglycan biosynthesis and degradation proteins [BR:ata01011]
 Precursor biosynthesis
  Racemase
   AWN88_14555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AMD59486
UniProt: A0A109VTY6
Position
linear:complement(673282..674103)
Genome map
AA seq 273 aa AA seqDB search
MLKTSEAATDVLKPVLVFDSGIGGLTVLREARVLMPERGFIYVADDAGFPYGGWEEEALR
ARILSLFEKLLQDFSPEVCVIACNTAFTLAGADLRARFPQMTFVGTVPAIKPAAERTRSG
LVSVLATPGTVKRAYTRDLIQSFATQCHVRLVGSENLARMAESWIRGEPVSEEAVLAEIE
PCFIESDGKRTDIVVLACTHYPFMANVFRRLAPWPVDWLDPAEAIARRARHLVPMPQDAE
HPDGFDFAVFTSGKPDFATRRLMQGFGLSVSVS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagacgagtgaggcggccaccgacgtgctgaagccggtgctggtgttcgattcc
ggcattggcgggctgactgtgctgcgcgaagcgcgcgtgctgatgcccgagcgcggtttc
atctatgtggccgacgacgccggttttccctatggcggctgggaggaggaggcgctcagg
gcgcgcattctctcgctttttgaaaaactgctgcaggatttcagcccggaagtctgcgtc
attgcctgcaataccgccttcacgcttgccggtgccgatctgcgtgcccggtttccgcag
atgacctttgtcggaacagtacccgccatcaaaccggcggcggagcgcacccgttccggc
ctcgtctccgttctggcgacgcccggcaccgtcaagcgtgcctatacgcgcgatctcatc
cagtccttcgcgacgcaatgccatgtccgccttgtcggctcggaaaaccttgcgcgcatg
gccgaaagctggatcaggggggagccggtgtcggaagaggcggtgcttgccgaaatcgaa
ccctgttttatcgaaagcgatggaaaacgcacagatatcgtcgttctcgcctgcacccac
tatcctttcatggccaacgtgtttcgccgtctggcgccctggccggtagactggctcgat
cccgccgaggcaattgcaagacgtgcccgtcatctggtgccgatgccccaggatgccgaa
caccccgatggattcgacttcgccgtcttcacatctggcaagccggactttgccacgcgg
cggctgatgcagggttttggcctcagcgtctccgtgtcctga

DBGET integrated database retrieval system