KEGG   Agrobacterium tumefaciens S33: AWN88_18700Help
Entry
AWN88_18700       CDS       T04213                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00071  Fatty acid degradation
ata00072  Synthesis and degradation of ketone bodies
ata00280  Valine, leucine and isoleucine degradation
ata00310  Lysine degradation
ata00362  Benzoate degradation
ata00380  Tryptophan metabolism
ata00620  Pyruvate metabolism
ata00630  Glyoxylate and dicarboxylate metabolism
ata00640  Propanoate metabolism
ata00650  Butanoate metabolism
ata00900  Terpenoid backbone biosynthesis
ata01100  Metabolic pathways
ata01110  Biosynthesis of secondary metabolites
ata01120  Microbial metabolism in diverse environments
ata01130  Biosynthesis of antibiotics
ata01200  Carbon metabolism
ata01212  Fatty acid metabolism
ata02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWN88_18700
   00630 Glyoxylate and dicarboxylate metabolism
    AWN88_18700
   00640 Propanoate metabolism
    AWN88_18700
   00650 Butanoate metabolism
    AWN88_18700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWN88_18700
   00072 Synthesis and degradation of ketone bodies
    AWN88_18700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWN88_18700
   00310 Lysine degradation
    AWN88_18700
   00380 Tryptophan metabolism
    AWN88_18700
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWN88_18700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWN88_18700
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWN88_18700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ata04147]
    AWN88_18700
Enzymes [BR:ata01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWN88_18700
Exosome [BR:ata04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWN88_18700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMD60233
UniProt: A0A0X8J0R0
Position
linear:1568616..1569797
Genome map
AA seq 393 aa AA seqDB search
MTLPSIVIASAARTAVGSFNGHFANTPAHELGATVISAVLERAGVAANEIDEVILGQVLT
AGEGQNPARQAAMKAGIPQEATAFGLNQLCGSGLRAVALGMQQILTGDADIVIAGGQESM
SMAPHCAHLRGGVKMGDFKMIDTMLKDGLTDAFYGYHMGITAENIARQWQLSRDEQDQFA
VSSQNKAEAAQAAGRFVDEIVAFTVKGRKADIVIDADEHIRAGASLETMAKLRPAFDKDG
TVTAGNASGLNDGAAATLLMSEQEAEKRGIKPLARIASWATAGVDPQIMGTGPIPASRKA
LAKAGWSIGDIGLVEANEAFAAQSCAVVRELGLDPDIVNVNGGAIAIGHPIGASGARVLN
TLIYEMRRRNVSKGLATLCIGGGMGVAMCIEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccttcaatcgtgattgccagcgctgcgcgcaccgccgtcggttctttcaat
ggccactttgccaatacgccagcccacgaactcggcgcgaccgttatcagtgccgtgctt
gaacgtgccggcgttgcggcgaacgaaattgatgaagtcattctcggtcaggtgctcacc
gcgggcgaagggcagaacccggcgcggcaagcggcaatgaaggcaggcattccgcaggaa
gcgaccgctttcggcctcaaccagctctgcggctcgggactgcgcgccgtggccctcggc
atgcagcaaatcttgacgggtgatgcggacatcgtcattgccggcggtcaggaatccatg
tccatggcacctcactgcgcccatttgcgtggcggcgtgaaaatgggcgacttcaagatg
atcgacaccatgctgaaggacggcctgaccgacgccttttacggctatcacatgggcatc
accgctgaaaacatagcccgccagtggcaactctcccgggatgagcaggaccagtttgcg
gtctcatcgcaaaacaaggctgaagccgcacaggctgccggacgtttcgtggacgaaatc
gtcgctttcaccgtgaagggccgcaaggccgatatcgtcatcgacgccgatgaacatatc
cgcgccggcgcctcgctggaaacaatggccaagttgcgccctgccttcgacaaggacggc
accgtgacggcggggaacgcctcaggtctgaacgacggcgcagccgccacgcttttgatg
tcggaacaggaagcagaaaagcgcggcatcaagccactggcccgtattgcctcctgggcg
acggcgggcgtcgatccgcagatcatgggcaccggccccattcccgcctcccgcaaggcc
ttggccaaggccggctggtcgataggcgatatcggcctcgtcgaagccaacgaagcgttt
gcagcccagtcctgtgccgtcgtgcgcgagcttggccttgatcctgatatcgtcaacgtc
aacggcggagcgattgccatcggccatccgatcggcgcttcgggcgcccgcgtcctgaac
accctgatttacgagatgcgccgccgtaacgtatccaagggtcttgcgacactctgcatc
ggcggcggcatgggtgtagccatgtgcatcgaggcgctctga

DBGET integrated database retrieval system