KEGG   Agrobacterium tumefaciens S33: AWN88_21130Help
Entry
AWN88_21130       CDS       T04213                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00770  Pantothenate and CoA biosynthesis
ata01100  Metabolic pathways
Module
ata_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AWN88_21130
Enzymes [BR:ata01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AWN88_21130
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AWN88_21130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4 IlvN Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AMD60647
UniProt: A0A0X8J1J0
Position
linear:2053809..2055014
Genome map
AA seq 401 aa AA seqDB search
MALSDKHILLIISGGIAAYKSLDLIRRLKERGAKVTPVMTKGAQEFITPLAVGALSATHV
FTELFSRQDEQDVGHIRLARDCDLVLVAPATADLMAKTAHGLADDLASAVLLATDRKVLV
APAMNPKMWSAKPTIRNVDTLKKDGVFFVGPMAGEMAEKGEAGLGRMAEPLQIVQAVEAL
LDGGTKPLKGKTAIVTSGPTHEPIDPVRYIANRSSGKQGHAIAAALAELGADVTLVSGPV
TIADPAGVTVIHVERAEEMRDAVISRLPSDIAVMVAAVADWRVAGSSEQKIKKQPGDAPP
ALQLTENPDILKTVGHHENRPKLVVGFAAETQDVEKNGRAKLERKGADYIVANDVSAQTG
IMGGDRNSVKIISAEGVEAWPDLDKAEVAKRLAAFVAEKLT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcgctttcagacaaacatattctcctcatcatatcaggcggcatcgcggcctataag
agcctcgacctcatccgccgtctgaaagagcgcggcgcaaaggttacgcctgtcatgacg
aaaggcgcgcaggaatttatcaccccgctcgccgttggtgcattgtctgccacccatgtt
ttcacggagcttttttcacggcaggacgagcaggatgttggccatatcaggctggcgcgc
gattgcgatctcgtgctggtggcgcccgccaccgccgatctcatggcgaagacggcacat
ggtttggccgatgatctagcttcggcggtccttcttgcgaccgaccgcaaggtgctggtt
gcgccggcgatgaacccaaaaatgtggtcggcaaagccaacaatacgcaatgtcgatacg
ctgaagaaagacggtgtgtttttcgtcggaccaatggccggcgagatggctgagaagggg
gaggctggtctcggccgaatggcggagcctttacagatcgtccaagccgttgaagcgctg
ctggatggggggacgaagcccctgaagggcaagacggcgatcgtgacctccggccctacg
catgagccgatcgatcccgtgcgctacatcgccaaccgttcatcgggcaagcagggccat
gcgattgcagcggctctcgcggaactcggtgcagacgtaacgctggtttccgggccggtg
accattgctgatcccgccggtgtgacggtaatccatgtcgagcgcgccgaagaaatgcgg
gacgcggtgatctcaaggctgccgtcggatatcgccgtcatggttgccgccgtcgccgac
tggcgggtggcgggttcatcagaacaaaagatcaagaaacagccgggtgatgcgccgccg
gcgctccagctgacagaaaatcccgatattctcaaaaccgtcggccaccatgaaaaccgt
ccaaagctagtggtgggcttcgctgccgaaacgcaggacgtggaaaaaaacggtcgcgcc
aaactggaacgcaagggcgcggattacatcgtcgccaacgacgtctcggcgcaaaccgga
atcatgggtggagaccgcaacagcgtgaaaatcatttcggctgagggtgttgaggcatgg
ccggatctcgataaggccgaagtggcaaaacgtctggcagcctttgtcgcggagaaactc
acatga

DBGET integrated database retrieval system