KEGG   Agrobacterium tumefaciens S33: AWN88_21730Help
Entry
AWN88_21730       CDS       T04213                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ata  Agrobacterium tumefaciens S33
Brite
KEGG Orthology (KO) [BR:ata00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AWN88_21730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AMD60754
UniProt: A0A0X8J1R3
Position
linear:complement(2182180..2182572)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVDPYYLEEQSDPDDDRYVWGYKVVIANNSDVPVTLVNRYWHITDQNGQ
VDEVYGPGVLGEQPHLEPGDTYEYSSGCPLDTPSGLMFGHYEMETESGEVFNVTIPAFSL
DSPGLMRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgctttgacaagggatatcgaggtgacggttgatccgtattatctcgaagaa
caatccgacccggatgacgaccgctacgtctggggatacaaggtcgtgatcgcgaataac
tcggatgttcccgttactctcgtcaatcgctattggcatatcactgaccagaatggacag
gtggacgaagtctacggaccgggtgttctgggagaacaaccgcatctcgagcccggcgac
acctacgaatattcctccggctgcccgttggacacgccgtccggccttatgttcggacat
tacgagatggaaacggaaagcggagaagtgttcaacgtcaccatacccgctttttcgctg
gattctccggggctgatgcgggtcttgaactga

DBGET integrated database retrieval system