KEGG   Agrobacterium tumefaciens S33: AWN88_23615Help
Entry
AWN88_23615       CDS       T04213                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00361  Chlorocyclohexane and chlorobenzene degradation
ata00625  Chloroalkane and chloroalkene degradation
ata01100  Metabolic pathways
ata01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AWN88_23615
   00361 Chlorocyclohexane and chlorobenzene degradation
    AWN88_23615
Enzymes [BR:ata01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AWN88_23615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like PET122 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AMD61088
UniProt: A0A0X8J2D0
Position
linear:complement(2564685..2565296)
Genome map
AA seq 203 aa AA seqDB search
MTKIEHIVFDIGKVLIHYDPHIPYSRLIPDADERQWFFENVCTHDWNLEQDRGRRWEDAE
ALLVEKFPEREEHIRSFRKFWHEMVSHSYDDSVAIMTGLIESGHDVTMLTNFASDTFREA
QKMFPFLTLPRGVTVSGDIKLIKPDVAIYELHARDFGLNPAATLFIDDTAINVEGAKAAG
WQAVQFTGAEKLKQDLQAFGVAV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagattgagcatatcgtattcgacatcggcaaggtgctgatccattacgatccg
catattccctatagccgtctcattcccgatgccgatgagcgccaatggttcttcgagaat
gtctgcacccatgactggaacctcgagcaggatcgtggccgccgctgggaggatgccgaa
gctttgctggtggagaagttcccggaacgggaagagcacatccgctccttccgcaagttc
tggcacgagatggtctcgcattcctatgacgacagcgtcgcgatcatgacaggccttatc
gagagcggccacgacgtgacgatgctcaccaacttcgcctccgacacttttcgtgaggcg
caaaagatgttccccttcctcaccctgccgcgtggcgtcaccgtttccggtgacatcaag
ctgatcaaaccggatgtggcgatttatgagcttcatgcgcgcgatttcgggctcaatccc
gccgcaactctgttcatcgatgatactgcgatcaatgtcgaaggcgcaaaggccgccggc
tggcaggcggtgcagttcaccggcgcggagaagctgaagcaggatctgcaggcatttggg
gtggcggtttag

DBGET integrated database retrieval system