KEGG   Aethina tumida (small hive beetle): 109595128Help
Entry
109595128         CDS       T06105                                 

Definition
(RefSeq) probable dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00510  N-Glycan biosynthesis
atd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109595128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:atd01003]
    109595128
Enzymes [BR:atd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     109595128
Glycosyltransferases [BR:atd01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   109595128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 MapZ_C2 GxDLY
Motif
Other DBs
NCBI-GeneID: 109595128
NCBI-ProteinID: XP_019865984
Position
Unknown
AA seq 280 aa AA seqDB search
MIKFVVVLSAILVALFLNLEVSYQQDLTLTIRNNKMVSKSKNVENKYSILLPTYNEVENL
PIITWLIVKHMTKSGYPFEIIIIDDGSPDGTLEAAQELQKIYGKDKIVLKPREKKLGLGT
AYIHGIKYSTGNFIFIMDADLSHHPKFMPEMIEKQIQNDFDIVSGTRYVGTGGVYGWDFK
RKLISRGANFLTQLLLRPGASDLTGSFRLYRKDVLEKIINNCVSKGYVFQMEMIIRARQF
NYTVGEVPITFVDRVYGESKLGGSEIFQFAKALLYLFATT
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatttgtggttgttttgtcggctatcttggtagccctgtttcttaacctagag
gtatcttatcaacaagatttgacgttgacaattcggaataacaaaatggtcagcaaaagt
aaaaacgttgaaaataaatattccattcttctgcctacatacaatgaagtcgagaattta
cccatcatcacatggcttattgtaaaacacatgacaaagagtggttatccttttgaaata
attatcattgatgatggaagtccagacggaactttggaagcagcccaagaacttcagaaa
atttatggaaaagacaaaattgtcctaaaacccagagaaaagaagttgggattaggtacg
gcttacattcatggcatcaaatattccacaggcaacttcatatttattatggacgctgat
cttagtcatcatccaaaatttatgcctgaaatgatagaaaagcaaatccaaaacgacttt
gatattgtttctggtacgcggtacgttggtactggaggcgtgtatggatgggatttcaaa
agaaagctgatctcaagaggtgcaaacttcctgactcagttacttcttcgtcctggagct
tcagacctaactggttctttcaggttgtatcgaaaagatgtactggagaagataataaat
aattgcgtatctaaaggatacgttttccaaatggaaatgattattagggcaaggcaattt
aactatactgttggtgaagttcctattacctttgtggatagggtttatggtgaatcaaaa
ctgggtggttctgaaatattccaatttgccaaggcacttctgtatttatttgctacaact
taa

DBGET integrated database retrieval system