KEGG   Aethina tumida (small hive beetle): 109596272Help
Entry
109596272         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: UDP-N-acetylglucosamine transferase subunit ALG14 homolog
  KO
K07441  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00510  N-Glycan biosynthesis
atd00513  Various types of N-glycan biosynthesis
atd01100  Metabolic pathways
Module
atd_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109596272
   00513 Various types of N-glycan biosynthesis
    109596272
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:atd01003]
    109596272
Enzymes [BR:atd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     109596272
Glycosyltransferases [BR:atd01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   109596272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alg14 MtN3_slv
Motif
Other DBs
NCBI-GeneID: 109596272
NCBI-ProteinID: XP_019867338
Position
Unknown
AA seq 233 aa AA seqDB search
MTLDSNCRQVVYEVCILLIFMACLRFMYVIFKITTGHNRKSSVRRTTPSSVLICLGSGGH
TTEMLKLIQPLNFTRYNPRYYVIANDDMNSLAQLRQLETYKRCELQHAYDDVPEITHQIL
PIPRCRKVNQSFFTSIFTTLHATLYCFYVIVYTLPDLILCNGPGTCIPVCFVAFFLKLTG
VKDIRIVFVESFCRTRTFSLSGKIMTYFADNFIVQWPTLKKKLKRSEYIGQLL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgattccaattgtcgacaagtcgtctatgaagtatgtatccttttaatattt
atggcatgtctccgtttcatgtacgttatattcaaaatcactaccggccacaacagaaaa
agtagcgtacgaagaaccacaccatccagtgtactgatatgtctcggttcaggagggcac
acaaccgaaatgctcaagcttattcaacctttaaactttacaagatacaacccaagatat
tacgtcattgccaatgatgatatgaatagtttagcacaactgaggcaattggaaacttat
aaacgttgtgaactgcagcatgcttatgatgatgtacctgaaattacacatcaaatctta
ccaattccaagatgtcgtaaagtcaaccagtccttttttacatctatttttacaaccttg
catgccacactttattgcttctatgtcatagtatatacacttcctgatttaattttgtgt
aatggtcctggtacttgtatacctgtatgctttgtggcatttttcttgaaacttacaggt
gtgaaagacataaggattgtgtttgtggaaagcttttgcagaactagaactttctctttg
agtggcaagattatgacatatttcgctgacaatttcatagtccagtggcctacactcaag
aaaaaattaaagagatcagaatatattggccaattgttgtga

DBGET integrated database retrieval system