KEGG   Aethina tumida (small hive beetle): 109597003Help
Entry
109597003         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: retinal dehydrogenase 2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00010  Glycolysis / Gluconeogenesis
atd00053  Ascorbate and aldarate metabolism
atd00071  Fatty acid degradation
atd00280  Valine, leucine and isoleucine degradation
atd00310  Lysine degradation
atd00330  Arginine and proline metabolism
atd00340  Histidine metabolism
atd00380  Tryptophan metabolism
atd00410  beta-Alanine metabolism
atd00561  Glycerolipid metabolism
atd00620  Pyruvate metabolism
atd00981  Insect hormone biosynthesis
atd01100  Metabolic pathways
Module
atd_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109597003
   00053 Ascorbate and aldarate metabolism
    109597003
   00620 Pyruvate metabolism
    109597003
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109597003
   00561 Glycerolipid metabolism
    109597003
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109597003
   00310 Lysine degradation
    109597003
   00330 Arginine and proline metabolism
    109597003
   00340 Histidine metabolism
    109597003
   00380 Tryptophan metabolism
    109597003
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109597003
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109597003
Enzymes [BR:atd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109597003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109597003
NCBI-ProteinID: XP_019868183
Position
Unknown
AA seq 505 aa AA seqDB search
MDTVRVKYTKLFINNEFVDAVNGKTFPTENPATGKKIADVAEAEKEDVDLAVKAAKAAFA
RGSEWRNMDASARGKLINTLADLLERDAKRLAALETLDNGKPVEDSLVEIQASADLLRYY
AGYCDKIYGNTIPADGNLFSMTKKEPIGVVGQIIPWNYPIPMAIWKWGPALAAGCTIVLK
PAEQTPLTSLELAALAKEAGFPKGVINVITGYGPSCGAPLALHNDVRKIAFTGSTDIGHK
IMEYAAKSNLKSVNLELGGKSPLVIFDDANVGEAVEIAHNAIFANHGQNCCAGSRTFVQA
GIYDEFVKKAANMARERKVGDPFAPDTQQGPQVSLLKTFFFFNNKYYQHLGXXAPLDKIL
RLVNTGIQEGAKLQTGGKQVGTEGYFVEPTVFSEVTDEMTIAKEEIFGPVQSILKFNTLE
EVIQRANNTAYGLAAGVITNNINNALVFSQAVEAGSVWVNCYDAITPQTPFGGFKKSGLG
RDLGAESLDGYLETKTITIKLPCKN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatactgttcgtgtaaaatatactaagcttttcatcaataacgaatttgttgatgca
gtcaatgggaaaacatttcccactgaaaacccagccaccggaaaaaaaatcgccgatgta
gcggaagctgaaaaagaggatgtagatttagcggtgaaagctgctaaagccgcatttgcc
cgtggatcagaatggagaaatatggatgcatcagctaggggaaaacttattaacactctt
gctgatttattggagagagatgctaagaggcttgcggcattggaaactctcgacaatgga
aaacctgttgaagactccctagtagaaattcaagcttcagctgatcttttacgttattat
gccggatattgcgataagatttatggaaacacaataccagctgatggcaatctcttctcc
atgacgaagaaggagcctattggagttgtgggacaaataattccatggaactacccaata
ccaatggctatttggaaatggggcccagctttggctgctgggtgcactatcgtcctcaaa
ccagctgaacaaacgcctttaacatcattggaactagctgcgttggcgaaggaagctggt
ttccccaagggtgtgattaatgtcattacaggatatggacccagttgcggcgcaccgtta
gctttgcataatgatgtccgaaaaattgctttcacgggatccaccgatattggacataaa
attatggaatacgctgctaaatcaaacttgaaaagcgttaatttggaactcggcggtaaa
agtcccttggtaatttttgatgacgccaatgtgggtgaagcggtggaaatagctcacaat
gccattttcgcgaatcatggacaaaactgttgcgctggctccagaacattcgtacaagcg
ggtatttatgatgaatttgtaaaaaaagcggccaatatggctagagagagaaaagttggt
gacccatttgccccagatacacaacaaggtccccaggttagtctcttaaaaacctttttc
ttctttaataataaatattatcaacatttaggttgataagctccattggataaaatttta
cgtcttgttaataccggaatacaagaaggagctaaactgcaaacaggaggaaaacaggta
ggtacagagggatattttgtggaaccaactgtgttttctgaggtgaccgacgagatgact
atcgcaaaagaagagatatttggacctgttcagtctatattgaaatttaatacattggaa
gaagtcattcaaagagcaaataatactgcttatggtttagctgctggagtaataaccaat
aatattaacaatgcccttgtattttcacaagcagtagaagctggatctgtatgggtcaac
tgttatgatgcaattactccacaaacaccttttggaggctttaaaaagtctggattaggt
agagacttgggggctgagtcgttggatggatacctagaaacaaaaacaatcaccattaag
ttgccttgcaaaaattga

DBGET integrated database retrieval system