KEGG   Aethina tumida (small hive beetle): 109598157Help
Entry
109598157         CDS       T06105                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00230  Purine metabolism
atd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109598157
Enzymes [BR:atd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109598157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB DUF2730
Motif
Other DBs
NCBI-GeneID: 109598157
NCBI-ProteinID: XP_019869558
Position
Unknown
AA seq 600 aa AA seqDB search
MYGFVNYALELLVLKTFGPETWETIKKKADVQMEGQFLVRQIYDDEITYNLIFAAVDILK
IPANDILELFGKMFFEFCQDSGYDKILQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSF
RCTERPEDGALILHYYSDRPGLEYIVIGIVKTVASKLHNTEVDVQIIRTKEDCDHIQFLI
TETNAPEKIHLPDIDEIETLSLEPKVSPATFCRIFPFHIMFDREMKIVQTGSTLRRVFPI
VKSPNCKITDILDAIRPHLELTFENILSHINTIYVLRTRSGVMKVSASEEYRFLRLKGQM
LYVPETDLVIFLCYPSVMNLDDLTRRGFYISDIPLHDATRDLVLMSEQFEADYKLTRNLE
ILTDKLQQTYRELETEKKKTDGLLYSVLPLTVASELRHNRPVPPKKFDFVTLLFSGIVGF
SEYCAAHTDSNGAMKIVKMLNELYTKFDTLTDYSVNPDIYKVETVGDKYMAVSGIPEPCV
AHAKNIARLALDMMDLGKTIIVDGDPVRITIGIHSGEVVTGVIGQRMPRYCLYGNTVNLT
SRTETTGQPGKINVSGDAYKVLMQEDNKDPNFAFEYRGPITMKGKSEPMDVWFLTRANHN
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttttgtaaattatgctttggagttgttggttttgaaaactttcgggccggaa
acgtgggaaacaataaaaaaaaaggccgatgttcagatggaaggtcagtttttggtgaga
caaatctatgatgatgagataacgtacaatttgatttttgctgcagtcgatattttaaaa
ataccggcaaatgatattttggagctctttggaaaaatgttctttgagttttgccaagat
tctggatacgataagatcctgcaagttttgggagctacaccaagggattttcttcagaac
cttgatgcgctccatgaccacttggggacgctgtacccaggaatgcgagctccgtctttc
cgatgcaccgagaggccggaagatggcgctctaatactgcattattattctgacaggccc
ggactggaatacattgttatcggaatcgtcaaaactgttgccagcaaattgcacaatacg
gaagtggacgttcaaattatcaggaccaaagaagattgcgaccatattcagtttttgatc
accgaaaccaatgcaccagaaaagatacatctcccagacattgatgaaattgaaaccttg
tctttagaaccgaaagtatcaccggcaactttttgcagaatattcccatttcatatcatg
ttcgatagagaaatgaagatcgtacaaactggttccactttgagaagggtttttcctatt
gttaaatcgccgaattgtaagatcacggatattttggatgcgatccgtccgcatttggag
ttgacgttcgagaacatcttgtcccacatcaatacgatctacgtacttagaacgagatct
ggtgtcatgaaagtcagcgcgtctgaagagtatcgcttcttgagattgaaagggcaaatg
ctgtacgttccggaaaccgatctggtaatcttcctctgttatccgagtgtgatgaatctc
gacgatctcacaagacgtggattctacataagtgacattccgcttcacgatgccaccaga
gatttggtcctgatgtccgaacagttcgaagccgactataagctcaccaggaatctagaa
atcctgacggataaattgcagcaaacctaccgtgaattggagacggaaaagaagaagact
gacggattgttgtattcggttttgccattaactgtggccagtgaattaaggcacaatcgt
ccggttccaccgaaaaaattcgactttgtgaccttattgttctctggaatcgttggattc
tccgaatattgcgcagctcatactgactcaaatggagcgatgaagattgtcaagatgttg
aacgagctgtacaccaagtttgacactttgaccgactactctgttaatccagatatttat
aaagtggagacggtgggtgataagtatatggctgtgagtggaattccggaaccttgtgtg
gctcatgcaaagaacattgctcgtctggctttagacatgatggatctgggaaagactatt
atagttgatggagacccagtgaggattacaatcggcattcattcgggagaagtggtaact
ggagtaatcggacaaagaatgcctcgttattgtctttatggaaacactgttaatctaaca
agtcgaacagaaacaacaggacaacctggaaagatcaacgtttcaggagatgcttacaag
gttttgatgcaggaagacaacaaggatcctaattttgctttcgaatatagaggacccata
accatgaaaggaaaatctgaaccaatggatgtttggtttttgaccagggctaatcataat
taa

DBGET integrated database retrieval system