KEGG   Aethina tumida (small hive beetle): 109598426Help
Entry
109598426         CDS       T06105                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00020  Citrate cycle (TCA cycle)
atd00640  Propanoate metabolism
atd01100  Metabolic pathways
atd01200  Carbon metabolism
Module
atd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109598426
   00640 Propanoate metabolism
    109598426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atd04147]
    109598426
Enzymes [BR:atd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109598426
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109598426
Exosome [BR:atd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109598426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 109598426
NCBI-ProteinID: XP_019869898
Position
Unknown
AA seq 419 aa AA seqDB search
KSLGVQRRHLNVLEHVSYTLLKDAGITVPNFGVAKTKEEAKDIAAKLNTKDIVLKAQVLA
GGRGVGHFKNGLKGGVRMVFTPEEAEDIAGKMLGQYLVTKQTGEAGRLCNLVMVTERKFP
RREFYFSVMMERSFGGPVIIASSQGGVNIEDVAAQSPEAIIYEPVDIIKGLDNAQAEKVA
EKVGLGPQKKEAGDMLMKLYDLFIKKDALLIEINPYAEDTGDKFFSLDAKFRFDDNAEFR
QKELFALRDWTQEDEKEMQAAKFELNYIALDGNIGCMVNGAGLAMATCDTISLHGGSPAN
FLDVGGSASAAAVKEAFKIITSDPKVHAILVNIFGGIMRCDVIAEGIIAATKELGLKLPV
VCRLQGNNREKAAELIKASGLKILPVDDLDEATKLAVKLSNIVTLAKSANLAVNFEVKR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
aaatccctgggggtgcagaggaggcacctgaacgtgctggagcacgtcagctacacttta
ctcaaagatgcaggcataaccgtgccgaatttcggggtggccaaaaccaaggaggaggcc
aaggatatcgctgccaaattgaacaccaaggacatagtgttgaaggcgcaagtgctggct
ggcggtagaggagtcgggcacttcaaaaacggcctcaaggggggcgtgaggatggtgttc
acccccgaggaggccgaggacatagccgggaagatgctgggacagtatttggttacgaaa
caaactggcgaagctggcaggttgtgcaaccttgttatggtcaccgagaggaagttcccc
aggcgggaattttacttttcggtgatgatggagaggagtttcggaggtccagtcatcata
gcatcgtcgcaggggggtgtcaacattgaagacgtggctgcacaaagtcccgaagccatc
atatacgagcccgtggacatcatcaaggggttagacaacgcacaggcggaaaaggtggcg
gaaaaagtcggtctaggccctcagaaaaaagaggcgggcgacatgctgatgaaactgtac
gatctgttcataaaaaaggacgcgttgctcatcgaaatcaacccctacgccgaagacacg
ggcgacaagttcttctcgttggacgccaagttccgtttcgacgacaacgccgagttccga
cagaaggaactgttcgccctccgtgattggacgcaggaggacgagaaggagatgcaggcc
gctaagtttgagctcaattacatcgccttggacggcaacattgggtgcatggtgaacggg
gctggcctggccatggctacgtgcgacacaatcagcctccacggagggtcgccggccaat
ttcttggacgtggggggtagcgccagcgccgccgccgtcaaggaggcgttcaaaatcatc
acctctgaccccaaggtgcacgccatcttggtcaacatcttcggcggaatcatgaggtgc
gacgtcatagctgaggggataatcgcagcgaccaaggagttaggtctgaagctgccggtg
gtatgcagactgcagggtaacaacagggaaaaggcggccgaattgattaaggcaagtggg
ttgaaaattttgcctgtggatgacttggatgaagccaccaaattggcggtgaagctatcg
aatattgtgaccttggcgaagagtgccaacttggccgtcaactttgaggtcaaacgctga

DBGET integrated database retrieval system