KEGG   Aethina tumida (small hive beetle): 109600101Help
Entry
109600101         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dolichyldiphosphatase 1-like
  KO
K07252  dolichyldiphosphatase [EC:3.6.1.43]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00510  N-Glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109600101
Enzymes [BR:atd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.43  dolichyldiphosphatase
     109600101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 DUF212 YqhR YMF19
Motif
Other DBs
NCBI-GeneID: 109600101
NCBI-ProteinID: XP_019871737
Position
Unknown
AA seq 235 aa AA seqDB search
SKTLDENNIQWVPLSLTLVEYPKGDLIGKFMAFISLAPFGIGAGFVALILFRRDLHTITF
FIGTLCSEVLNYCIKHTVCEERPLRRDHQYVEYGMPSSHSQFVWFFATYVIYFVFIRLHH
LNNNTIIENVSKFLIISSSVVMALLVSISRIYLHYHTIAQVLCGALVGVLFATVWFALTY
LVFTPLFPQVVTWRISEILLLRDTTLIPNVLWFEYTNTRQEVRARSRKLVSMKSQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
tcaaaaacattagacgaaaataacatacaatgggtgccactcagtctgaccctggttgaa
tatccaaaaggtgatctcattggcaaatttatggcgttcataagtctggccccctttgga
ataggtgcgggttttgtggcgctaatcctgttcaggagggatctacatactattacgttt
ttcataggtactttgtgctcagaagtacttaattattgtataaaacacactgtttgcgag
gagagacctttgaggagggatcaccaatatgtagaatatggaatgccttcatcacattct
cagttcgtgtggttttttgccacatatgttatttattttgtatttattaggttacaccac
ttgaataacaacaccataatagaaaatgtatcaaagttcttgataatttcctcgtctgtt
gttatggcattgctggtttcgatatctagaatatatttgcactatcatacaattgctcaa
gtactatgtggggcgcttgtgggggtgctgtttgcaactgtatggtttgccctcacctat
ttagtgttcacgccacttttcccgcaagtggtcacctggaggatatcggagatcctgttg
ctgcgcgacacgacgctgataccaaacgttctgtggttcgagtacacgaacacgcggcag
gaggtgcgtgccagaagtcgtaaactggtcagtatgaagtcacaatga

DBGET integrated database retrieval system