KEGG   Aethina tumida (small hive beetle): 109601102Help
Entry
109601102         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04136  Autophagy - other
atd04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:atd00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109601102
   04136 Autophagy - other
    109601102
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:atd04131]
    109601102
   03029 Mitochondrial biogenesis [BR:atd03029]
    109601102
Membrane trafficking [BR:atd04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109601102
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109601102
Mitochondrial biogenesis [BR:atd03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109601102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 eIF2A ANAPC4_WD40 KASH_CCD DUF4472 Shugoshin_N CENP-H Peptidase_M13
Motif
Other DBs
NCBI-GeneID: 109601102
NCBI-ProteinID: XP_019872882
Position
Unknown
AA seq 349 aa AA seqDB search
MATETTKWRDNILNQLQFRNRNETHCFQDLINQHIRVFETANVLRNENLQLSVQNEKLKF
EGLTNTGSGGVTDSRLQEKIQHLEQKLLAQAEELTELHRRKGENAQQIIDLNAKVLEKDK
QLVSKDVTLAENAAKIASLKAEVSLYEKSNKELKYLNDTLRDEHTALQLAFTALEDKLRK
VQDENREMVDRLIKYKAKDADRMNEENDNFLKKRHAKMQKEIEEACRDTRGVSPEEIQEG
FGPVCQSTLPTKVNVKFDAHEGEVNAVKWSPVDRIVATGGADRKVKLWDISKGSFESKGI
LVGSNAGVMAVDFDPSGALILGASNDYASRVWTVADQRLRVSTVQNFHP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaaccaccaaatggagggacaacatattaaaccagctgcaatttaggaac
cgaaacgagacgcattgcttccaggacttgataaatcaacacatacgagtgttcgagacg
gccaacgtgctcagaaacgaaaacctacaactgtcggtacaaaatgagaaacttaagttc
gagggactcaccaatacgggctcgggcggcgtcaccgacagccgtttgcaggagaaaata
cagcacttggaacagaagttgttggcccaggccgaagagctgaccgagctgcacaggagg
aaaggggagaatgcgcaacaaatcatagatctgaacgctaaagttcttgagaaagacaag
cagctcgtctctaaagatgtcacgttggctgagaatgctgctaaaattgccagcttgaag
gctgaagtgtctttgtatgagaagtctaataaagaattaaaatacttaaacgatacttta
agagatgaacatacagccttacaattggcctttaccgccttagaagataaacttaggaaa
gtacaagacgagaacagggaaatggtcgataggctaatcaagtacaaagctaaggacgca
gaccgaatgaacgaggagaacgataacttcctgaagaagcgacacgccaaaatgcagaag
gagatcgaggaggcgtgccgcgacaccagaggcgtgtcgccggaggagatacaggaggga
ttcggtcccgtttgtcagtccacgctacccacgaaagtcaacgtcaaattcgacgcacac
gaaggcgaagtgaacgcggtgaagtggagtcctgtggaccgtatagtagctaccggtggt
gctgaccgaaaggtcaaactgtgggacatttccaaaggatcctttgaaagtaaagggatt
ctggtgggaagtaatgcgggtgttatggctgtagatttcgatccttctggtgctttaatt
ttgggggcttccaatgactatgctagcagggtgtggacggtcgctgatcagagattaagg
gtaagtactgtacagaatttccacccttaa

DBGET integrated database retrieval system