KEGG   Aethina tumida (small hive beetle): 109601695Help
Entry
109601695         CDS       T06105                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109601695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109601695
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:atd03036]
    109601695
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109601695
Protein kinases [BR:atd01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109601695
Chromosome and associated proteins [BR:atd03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109601695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 C1_2 DUF4407 APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 109601695
NCBI-ProteinID: XP_019873527
Position
Unknown
AA seq 1360 aa AA seqDB search
MDIIHDEDRKRRLRLLEEKIQDPRGKGNIDSLLDTVQALYTDCDHATIKKMKNVEVYLNR
YDEFASDIINLRMKTDDFDNIKVIGRGAFGKVQLVRHKHTKQVYAMKRLSKADLIKRSDS
AFFWEERHIMAHAKSEWIVQLHFAFQDAKHLYMVMDYMPGGDIVNLMSNYDIPETWAKFY
TMEVVLALDVIHSMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMDEDGLVRSNNVVGTP
DYISPEVLQSHGKGIYGRECDWWSVGIFVYEMLVGETPFYADSLLGTYNKIMYHENNLSF
PDEVEISNEAKSLIQGLLCDRTKRLGRNSVDEIKNHPFFINNEQWTFENLRDSVPPVVPE
LSGDDDTSNFDDYEKDESPEEVFPVPNNFVGNHLPFIGFTYNSDYKLLSGDSVVDGMVYN
NKESFAQVSKLETLLEQERGKVEALEGKQRILIAQLDNLAQKELEVRDEAAKYEKEIAIL
KHTYKEVQRKAECESELRRNTEKYLSELKKRYEDEQSKRTREMNNNHNEKIHLLEKQVND
MQEKLKVETENCQKLRKQANELTMAKSNSELKVNEYYAKIQSLQTQRDSLQAEVESLQTQ
LMEERNSRSQASDQQMVLENKIQSLSAELERSQQRENKISVDNSQLTERVSFLEKECAGL
DLELKTAQTLYQQEVRAHEETEKSRMLNKEEANMEVVKALQTKLNEEKSARQKADMNSQE
KERQISMLSVDYRQIQQRLQKLEGEYRQEVEKVKALHGQIEQEQQKKSILQSEMAQQASE
LAKLKVKETTIAAELQTISEAKKIIEEEMLKTKRSLQMEQLQMKELQDSLEAEQYFSTLY
KTQTHELKEELEETXKKINREFEEERASLKHQCQLAVARADSEALARSIAEETVAELEKD
KTMKELEHKDLITKHRNDLNAKEGLLNQLRDRELEYKKAAEKIQKEYDELFKQHSKLQDE
YQKNSGNQLEIEKLKTKLNTEQLLKQQAVNKLHEIMNRKDVNNTKGKSKISSADLRRKEK
DLKKLQQELSQEREKFNTIVLSYQKNIQELQSQFNDEQSTRQRLQMELDSKDSEIEQLHQ
RIQAMNSETASLSSADNEGDEINSESIFEGWLSIPSKQNIRRHGWKKQYVVVSSRKIIFY
NSENDKLNTDPVIVLDLCKVFHVRSVTLGDVIRADPKDIPRIFQLLYAGEGENRKPDDQN
NTLDVSSLKSFDDKPMSVSHKGHELFNISYHMPTTCEVCPKPMWHMFKPPPAYECKRCRM
KFHKDHIEKNDNVPPCKLHYDPSYAKELLLLAPSPEEQNSWVTRLSRKIQKCGFKANNSN
AIDSSAKISPRESTRSSLKPYLNVQQRSATLPANSSMGSK
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atggacataatacatgatgaggaccgaaagaggaggctacgcctccttgaggaaaaaatt
caagatcccaggggcaaagggaacattgactcactgctggacacggtgcaggccctgtac
accgattgtgatcatgccaccattaagaagatgaagaatgtagaggtctatttgaacaga
tatgatgagttcgccagcgacatcataaacctgcgcatgaagaccgacgacttcgataac
ataaaagtgatcggtcgcggcgccttcggcaaagtacagctggtccgacacaagcacacc
aaacaggtgtacgccatgaagcgattgagcaaagccgacctaatcaaaaggtcggattcg
gccttcttctgggaggaacgtcacatcatggcgcacgccaaatccgagtggatcgttcag
ctgcacttcgcctttcaagacgccaaacatctctacatggtcatggattacatgcccggc
ggcgacatcgtcaatctgatgtccaactacgacataccggagacctgggccaagttctac
accatggaggttgtgttggcgttggacgtcatacattcgatgggtttcgtgcacagggac
gtgaagccggacaacatgttgctggacaagtacgggcacttgaagctggccgatttcggt
acgtgcatgaggatggacgaggacgggttggttaggtccaacaatgtggtgggcactccg
gattacatatcgccggaggtgctgcagagccacggcaagggtatatacggacgggagtgc
gactggtggtccgtcggtatattcgtctacgagatgttggtgggtgagacgcccttctac
gccgacagtctcctgggtacttacaacaagatcatgtatcacgagaacaacctgtcgttc
cccgacgaggtggaaatctccaacgaggccaaatccttgatacaaggattactatgtgat
agaactaaacgcttaggaaggaatagtgtagatgaaatcaagaaccatccattcttcatc
aacaatgaacagtggacgttcgagaatctacgcgactccgtaccgcctgtagtgcctgaa
cttagtggtgacgatgacaccagcaatttcgacgattacgagaaggacgagagtcccgag
gaagtttttccagtgccaaataatttcgtaggtaaccacttacccttcataggttttacg
tacaactccgactacaaactactttccggcgattccgtcgtggacgggatggtctacaac
aacaaagaatcatttgctcaagtgtcgaaactagaaaccctgttagagcaagagcgaggc
aaagtggaggcgctcgaaggcaaacaacgaatactaattgctcaattggataatcttgcc
caaaaagaactggaggtacgggacgaagcggccaagtacgagaaagaaattgccattctg
aaacacacctataaagaagtccaaaggaaggccgaatgcgagagcgaactgagaaggaac
accgaaaagtacctctctgagcttaaaaaacgctatgaggacgagcagagcaaacgcacc
cgagaaatgaacaacaatcacaatgaaaagatccacttgctggaaaaacaagtgaacgac
atgcaggagaaacttaaagttgaaactgagaactgccagaagttgaggaaacaagccaac
gaactgacaatggctaaatccaactccgagttgaaggtcaacgagtactacgccaagatt
cagtcgctgcagacgcaaagggactccctccaggcggaagtggagtcgctccagacgcag
ctgatggaggaaaggaactccaggtcgcaggcttccgaccaacaaatggtactggagaac
aagatccagtcgttgagcgccgaattggagaggagtcagcagagggagaacaaaatttcg
gtcgacaactcccagctgacggaacgggtgtcgtttttggaaaaggaatgtgccggcttg
gatttggaactcaagacggcgcaaactttgtaccagcaagaagtgcgagcccatgaggaa
actgagaagagcagaatgttgaacaaggaagaagccaacatggaagttgtcaaagcctta
caaaccaagttgaacgaagagaaaagtgccagacagaaggcagacatgaattcccaagaa
aaggaacgccaaatttccatgctctccgtcgactaccgacaaatccagcaacgtttacaa
aaacttgaaggcgagtaccgtcaggaagtggagaaggtgaaagccctgcacggtcagata
gagcaggagcaacagaagaagtcaattctacaatctgagatggcccaacaagccagcgaa
ctggctaaactgaaggtgaaagagaccaccatagcagccgaattgcaaaccatcagcgag
gccaagaaaatcatcgaggaagaaatgctgaagacaaaacggtccttacaaatggagcaa
ctgcagatgaaggaattgcaggattccctcgaggccgaacagtacttctctaccttgtac
aaaacccaaacccacgagctaaaggaagaactggaggagaccnnaaaaaaaatcaacagg
gaattcgaggaggagagggcgtcgctgaaacaccagtgtcaattggccgttgcccgagcc
gattccgaagctttagcccgctccattgccgaagaaaccgttgccgaactagaaaaggat
aagacaatgaaggagttggagcacaaggatctaatcaccaaacatcgcaacgacctgaac
gccaaagaaggtttgctgaaccaactgcgcgaccgtgaactcgaatacaagaaggcggcc
gagaagatccaaaaggagtacgacgaattgttcaagcagcacagcaagctgcaagacgag
taccaaaagaacagcggcaaccaactggaaatcgagaagctgaagaccaaactgaacacg
gaacagttactgaagcagcaagcggtcaacaagctgcacgagatcatgaacaggaaggac
gtgaacaacaccaagggcaagtcgaagatatccagcgccgacctcaggcgaaaggaaaag
gacctcaagaagctgcaacaggaactcagtcaggagagggagaaattcaacactattgtt
ttatcgtatcaaaaaaatattcaggagttacaatcgcagttcaatgacgagcaatcgaca
cgccaaaggttgcaaatggagctggacagcaaggactcggagatcgaacaactgcaccag
cgcatccaggcgatgaacagcgagacggcgtcactgagttccgcagacaacgaaggtgat
gaaatcaattccgagtcgattttcgagggttggctgtcgataccttcgaagcagaacatc
aggcggcacggctggaagaagcagtacgtcgtggtgtccagtcggaagatcatcttttac
aattcggagaacgacaagctgaatacagatcctgtgatagtgttagatttgtgcaaagtc
ttccatgtgcgatcggtgacgctgggtgacgtgatccgggctgaccccaaggacatacca
aggatcttccagctgctgtacgcaggggagggcgagaatcgcaagccggacgaccagaac
aacactctggacgtcagttcgctgaagagcttcgatgacaagccgatgtcggtgtcgcac
aaaggccacgaactgtttaacatctcctatcacatgcccaccacctgtgaggtctgtccc
aaacccatgtggcacatgttcaagcccccacctgcctatgaatgtaaacggtgtcgaatg
aaattccacaaagatcacatcgagaagaacgacaacgtgccgccgtgcaaactccactac
gacccgtcctatgccaaagaactgctgttgcttgcgccgtcgccggaggagcagaacagc
tgggtgacgcgcctcagtcgcaagatccagaagtgcggcttcaaggcgaacaactcaaat
gccatagactcatccgccaagatttcgcccagggagtcgacccgttcaagtttgaagcca
tatctgaacgttcaacagcgttccgccacattgcccgccaattcgtcgatgggcagcaaa
tga

DBGET integrated database retrieval system