KEGG   Aethina tumida (small hive beetle): 109603394Help
Entry
109603394         CDS       T06105                                 

Definition
(RefSeq) glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00480  Glutathione metabolism
atd00980  Metabolism of xenobiotics by cytochrome P450
atd00982  Drug metabolism - cytochrome P450
atd00983  Drug metabolism - other enzymes
atd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109603394
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109603394
   00982 Drug metabolism - cytochrome P450
    109603394
   00983 Drug metabolism - other enzymes
    109603394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atd02000]
    109603394
Enzymes [BR:atd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109603394
Transporters [BR:atd02000]
 Other transporters
  Pores ion channels [TC:1]
   109603394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_C_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_N_4
Motif
Other DBs
NCBI-GeneID: 109603394
NCBI-ProteinID: XP_019875448
Position
Unknown
AA seq 212 aa AA seqDB search
MKLYMIPQSPAVRAVMMVAKMLELDMEQVMVDMEKKEHLSAEFMKMNPQHTVPVLNDDGL
IVIDSHAIMAYLVGRYGKNDSMYPSNVQMRAAIDQMMYFDASVLQPRLGVIIKALLMGEM
KTVPKEMMQPVMEAYDMMERYLQKHNYVARDSLSIADFSVVATMTSMMHVVPMEMEKYPK
IMAWMKKMEMLPVYEENQKGLDMMMCMMKKMR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacatgatccctcaatcgccagctgttagggctgtaatgatggtcgccaaa
atgctcgaactggatatggaacaagttatggtcgacatggaaaagaaggagcatctttcc
gccgaatttatgaagatgaacccccagcacactgtgccagtactaaacgacgacggattg
attgttatcgatagtcatgcaattatggcttatttggtcggaaggtatggcaaaaatgac
tcaatgtatcccagtaatgtgcaaatgagggccgccattgaccaaatgatgtacttcgat
gcgagtgtgctccaaccaaggctcggcgtaattatcaaagccctccttatgggcgaaatg
aagacggtaccgaaggaaatgatgcaacctgtgatggaggcttacgatatgatggaacgt
tacctccagaaacataattatgtggccagggattccctgtccattgctgatttcagtgtt
gtagctacgatgacttctatgatgcacgttgtgcctatggaaatggagaagtaccctaaa
atcatggcttggatgaagaaaatggaaatgcttccagtttacgaggagaaccagaagggc
ttagatatgatgatgtgtatgatgaagaagatgagataa

DBGET integrated database retrieval system