KEGG   Aethina tumida (small hive beetle): 109603470Help
Entry
109603470         CDS       T06105                                 

Definition
(RefSeq) interleukin-1 receptor-associated kinase 4-like
Organism
atd  Aethina tumida (small hive beetle)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death_2 PIP49_C Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109603470
NCBI-ProteinID: XP_019875532
Position
Unknown
AA seq 626 aa AA seqDB search
MTTSEEVKLDPKLQLRKLDLRLLRELEAILDSDDLWKPLMCKIPKTLNTDPTMSKISHKN
PPKYNTEHFKIIESVSVKDRRSCTNILFDEWGTSGKVLPTVGHLFSLLKQAGVYRAGDLL
ADLLGVPRPERPATGPDALVKIQDVAPIIRVSGSIMKPTNVNRSVSHHHHTVHFENDEPD
LDFLLRDSEDVSNQSAVTPEQTVSENQMPDFSAIMPSGNPSTVSSGALPNLSMFQSTTDN
NVSNSGEYLPQFSKLGIDTSNEPITPQENSVPNLSFFQSTQELPVILLSNDQNNSSHSRN
TNSSRMCSSPLPSLSLNTSLPHFSYVDLERCTNNFNNDPYTSRESVGRYLGHGAFGSVYV
AFDLIKDPVAVKKLNLDLVNNNQMDQITKQFRNEVEILSKFKHDNLLALLGYSHDGCTYC
LVYEYMSGGTLHDKIQSQENRLHWKERLNISLGLSKAITYLHTEFKDPVIHRDIKSPNIL
LDESNKAKLGDFGLVRNIYNNHTSTFTSAIGTSAYMSDEALRGEISYKMDTYSFGIVLLE
LLTSLPVRDESRQEVCLNDHVEFQYSTDGNGSNLLDRHEEVGDWIANGIDIGEKLIEIAL
RCLKKKKIRPDQSEITENLLDLVKQI
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcagaagaagtgaaactagatccaaaactacaattaagaaaattagatcta
agactcctaagagagttagaggcaatactcgacagtgatgatttatggaaaccattaatg
tgtaaaataccaaaaacattaaacactgatccaacaatgtccaaaatatcacacaaaaac
ccacccaaatacaacacagaacatttcaaaatcattgagagtgtttctgtgaaagaccgc
cgttcatgcaccaatatactttttgacgaatggggcacttctggaaaggtgctccccacc
gtcggccacctattttctctgttaaaacaagctggagtatatagagctggcgatctgctt
gccgacttactaggcgttcctcgtccagaaaggcctgcgactggcccggatgctctggtg
aaaattcaagatgttgctccaataattagagtatccgggtctataatgaaacctacgaat
gtaaatcgtagtgtcagtcaccaccatcacacagtgcattttgaaaatgacgagcccgac
ttagatttccttctgagggacagtgaagatgtgtcaaaccagtccgcagtaacaccggaa
caaactgtctctgaaaatcaaatgcctgactttagtgccataatgccgtcgggcaatcca
tctacggtatcttcaggagctctccccaatttatccatgtttcaatcaaccaccgacaac
aatgtgtcgaatagtggcgaatatttgccacagttctccaaacttgggatagatacatca
aacgaaccaataacaccccaagaaaacagcgtgccaaatttaagtttctttcaaagtacc
caagaactgccggttattttactatccaacgatcaaaataattcatctcactcaagaaac
accaacagttcacggatgtgttcgtctcctctacctagtttatccctcaacacatcctta
ccacacttctcatacgtagatttagagaggtgcacgaataacttcaacaacgacccgtac
acatccagagagagcgtcggccgatacttgggccacggagcttttggttccgtctacgtc
gccttcgatttgattaaagatcctgtcgctgttaaaaaattgaacttggatctagtgaac
aacaatcaaatggaccaaattacaaaacaattccgtaacgaagtcgaaattttaagcaaa
tttaaacatgataatttgctagcacttctcgggtattcacacgacggttgtacatattgt
cttgtttacgagtatatgtctggtggtacattacatgataaaattcagtcacaggagaat
cgtttgcactggaaagagagattaaatatatctttgggtttgtcaaaagccattacttat
ttacatactgaatttaaagatcctgtgatacacagggacataaaaagccctaatatactg
cttgatgaaagcaataaggctaagttaggtgattttggactagttagaaatatctacaat
aatcatacaagcacttttactagtgcaataggaacgtctgcttatatgtcagatgaggcc
ttaagaggagaaatttcttacaaaatggacacatacagttttggaattgttttactggaa
ttactaacatccctaccagttagggatgaaagcagacaagaagtttgtttgaatgaccac
gttgaatttcaatatagtactgatggtaatggcagtaatttgttggatcgacacgaggaa
gttggggactggatagctaatggcattgacattggagaaaaactaatcgagattgctttg
agatgtctgaaaaagaaaaagataagacctgatcagagtgagatcaccgaaaatctttta
gatcttgtaaaacagatataa

DBGET integrated database retrieval system