KEGG   Aethina tumida (small hive beetle): 109603647Help
Entry
109603647         CDS       T06105                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00450  Selenocompound metabolism
atd00970  Aminoacyl-tRNA biosynthesis
atd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109603647
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109603647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:atd01007]
    109603647
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:atd03016]
    109603647
Enzymes [BR:atd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109603647
Amino acid related enzymes [BR:atd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109603647
Transfer RNA biogenesis [BR:atd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109603647
 Prokaryotic type
   Other AARSs
    109603647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e DUF2889 zf-H3C2
Motif
Other DBs
NCBI-GeneID: 109603647
NCBI-ProteinID: XP_019875701
Position
Unknown
AA seq 563 aa AA seqDB search
MIKSVQLIRTFSSKSNNISFLTTPIYYVNANPHIGHLYTSLIADAAQRWRRISDRGVKIE
FSTGTDEHGSKIQQAAAQFKKTPSEYCDDISTQYKKLASEFGVGHTKFIRTSDQGHKETV
WKFWVPTFLSDKRLIYQSKYEGWYCVSDETFLVETQLKENVSKDGKKVLVSLESGHPVEW
TEEQNYIFKLASFRNDLLYWLNQNNVIRPKKFQKILLDFLHNEDLPDLSISRPSSRVHWG
IQVPNDDSQTIYVWLDALVNYLTVAGYSTKSPEEFAKIWPPTLQVIGKDILKFHGIYWPA
FLMAADLAPPSSILCHSHWTVDGEKMSKSKGNVVCPFDRGGKYSADGLRYFLLREGVAHN
DGNYSDTKVIRILNSELADTLGNLLNRCTASSLNPEQIVPEIDRFTFESIASLDVTKKLI
ENVASLPDICEQHYSELNFYKSIDAIIAALHSANLFFETMKPWELKNRPETLEELKVVLH
ITLETLRVVGILLQPIVPNICDALLTRIQVGMEDRHLGNLAVLSWSDTNFRLRKLAGEKA
VLFRKIVTEEGKKHVARKSLKKV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagtgtacagttaattaggacgttcagttctaaatcaaataatattagtttt
ctcacaacacccatttattatgtgaatgcaaatccccacatcggacacctctacacttcg
ctgattgcagacgccgcacagagatggcgacgcatttcggatcgtggtgtgaaaatcgaa
ttttcgactggaacggacgaacacggctcgaaaattcaacaagcggccgcgcaattcaag
aaaacgccatccgagtattgcgacgacatttcaacgcaatacaaaaaattggcatcggaa
ttcggggtgggacacactaaatttattcggacttccgatcagggacataaagaaactgtc
tggaaattttgggtaccaacgtttttgagtgacaagcgcttgatctatcagtctaaatat
gaggggtggtattgtgtgtcagatgagacttttctagtcgaaacacaattaaaagagaat
gtctcaaaagacggtaaaaaagtattagtatctttggaaagtggacatccggttgaatgg
acagaagaacagaattacattttcaaattggcttcatttagaaatgacttactctattgg
ctcaaccaaaataatgtaatacgtccgaaaaaattccaaaaaattttacttgacttttta
cataacgaagatttaccggatctttcaatttcaagaccttcctcaagggtacattggggc
attcaagtaccaaacgatgattcgcaaacaatttacgtctggttggacgctttggttaat
tacttaactgtcgctggatactccacgaaatctccagaagaattcgctaaaatttggcca
ccaacacttcaagttattggaaaagatattctaaaatttcatgggatatattggccggct
ttcctcatggccgcagatttggcaccacccagttccattctttgtcactcccactggacc
gttgacggcgagaaaatgtccaagtccaaaggaaacgtggtctgtccctttgatcgcggt
ggcaaatattccgctgatggacttaggtattttcttttaagggaaggagttgcgcacaac
gacggaaattacagcgatacgaaagtgatacgtatcctgaattcggagctggcggacaca
ttggggaacctattgaatcgttgcactgcctcaagcttgaatccggaacagatcgttccg
gaaatcgaccgtttcaccttcgaatcaattgcaagtttggacgtgacgaagaagttgata
gaaaacgtcgcgtcgttgccagatatctgcgaacaacactattcagaactgaacttttac
aagtcaatagacgcgataatcgcagctctacattcggccaatctgtttttcgaaacaatg
aaaccgtgggagttgaaaaatcgtcccgaaaccctggaagaactgaaagtggtgctgcac
atcacgctggaaacgttgcgagtcgtcggtatacttttgcaaccgatcgttccgaacata
tgcgacgcgctgttgactagaattcaagtgggaatggaggacagacacctggggaatttg
gcggttctgtcctggagcgacacgaactttcgtctcaggaaattggcaggagagaaggca
gtattgtttcggaaaatcgtgacggaagaggggaagaaacatgtagcaaggaagtcgctg
aaaaaagtctaa

DBGET integrated database retrieval system