KEGG   Aethina tumida (small hive beetle): 109604169Help
Entry
109604169         CDS       T06105                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
atd  Aethina tumida (small hive beetle)
Brite
KEGG Orthology (KO) [BR:atd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109604169
   01009 Protein phosphatases and associated proteins [BR:atd01009]
    109604169
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109604169
Protein kinases [BR:atd01001]
 Serine/threonine kinases: Other
  Wnk family
   109604169
Protein phosphatases and associated proteins [BR:atd01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109604169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109604169
NCBI-ProteinID: XP_019876256
Position
Unknown
AA seq 987 aa AA seqDB search
MVEQPIVVSLQNKEGKPDDDDDVFKPIAVSPDGRFFKYEEEIGRGSFKTVYRGLDTQTGV
AVAWCELQEKKLNKAERQRFREEAEMLKKLQHPNIVRFYNYWEAPGTKKKNIVLVTELML
SGTLKTYLRRFKKINPKVLKSWCRQILKGLAFLHSRSPPIIHRDLKCDNIFITGTTGSVK
IGDLGLATLKNRSFAKSVIGTPEFMAPEMYEEHYDEGVDVYAFGMCMLEMATSEYPYSEC
TGPAQIYKKVISGVKPASFDKVQNPEVQNVIESCIKPRKEDRPKVKDLLTHAFFEEDVGL
KVEVVSQEESQKVVFRLRVIDPKKRTHKHKENEAIQFEFDMETDRYNTIAEEMAKSGIIF
EDDAKTVAQLLKAQITQITKEREQQRTKEKEALAQQLQYQQYLQKQAEHQQAQQQAAAAQ
QQQAYQQQAQPQQQQGAPPQQPQQQPQAQTQQAPPQYQQAAQPPQQPSFQQAQPQYDPVQ
QQQQQQQFQQQSQPQYTQPPQQSYQPQQTPQPSADQQQQPQYQQQPMQIDQNVLQGQYVQ
QQQPQQQDAQALLQHQYQQQQQTTIIPEQQQQPTQQPPPQQIYQQPQQEQTVTPPVLQRQ
TSVDPVQQQPIVHKQQQPPQQYQQYIPEGALPQQAEFLQVQENQQHKISSVSQPDMLCAT
SSTSEPPPQHRLSVDSQLDIHNQQQQFQQQFSQPQQQQPDYQTQPYQQQQPGQQPQPQQQ
YQPLGQDQQQQTYQQSQPPQPYQVAQDQNYQQPTQQQPPPTAQQPAYQNQQSQPYQQPAA
QSYQAQPPPQPYQQEQSYQPPPATYQPAPQQQQPPQQPYQQQTSQDMAQNYVQPQTYQQQ
PQQPTYQQQQPQPYPQQPPTYTPQQQQQQQYVAPPPQQQQPQQQDQSQQQVYQQQQFMAP
PQQQPPTAQPQPVVEQLQQPQPIYQQPQQIPQPQPQTYVQPAQAYVEPPPQQQQQQVYLP
VEHLPDQPAPPLGHPSVYHGAAPRPAA
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcagccgatcgtcgtctcgctgcagaacaaggagggcaagccggacgacgac
gatgacgtgttcaagccgatagccgtcagtccggatgggcggttcttcaaatacgaggag
gaaatcggtaggggttcgttcaagacggtatacaggggactggacacgcagacaggagtc
gcagttgcctggtgcgagttgcaagagaagaagctgaacaaggcggaacggcagcggttc
agggaggaggcggagatgttgaagaagttgcagcatcctaacatcgtacggttttataat
tactgggaggcgcccggcaccaaaaagaagaacatcgtgctcgtcaccgaactgatgttg
agtggcaccttaaaaacgtacttgagacgtttcaaaaagatcaatccaaaagtactaaag
tcttggtgcaggcaaattttaaagggattggcgtttttgcactcgaggtcacctcctata
atacacagagatttgaagtgtgacaacatcttcataaccggaacgacggggtcggttaag
atcggcgatttgggtttggccacgttgaagaacaggagtttcgccaaatcggtgataggc
acgcccgagttcatggcaccggaaatgtacgaggagcactacgacgagggcgtggacgtg
tacgcctttggcatgtgcatgctggagatggccaccagcgagtatccctattccgagtgc
accggccccgcccagatctacaagaaggtgatatcgggcgtcaagccggccagcttcgac
aaagtgcagaatccggaggtgcagaacgtgatcgagagctgcataaagccacgcaaagag
gacaggcctaaagtcaaggatctgttgacgcacgccttcttcgaggaggacgtcggtctg
aaggtggaagtggtcagtcaggaggagagccagaaggtggtgttcaggctgcgggtgatc
gaccccaagaagcggacgcacaagcacaaggagaacgaggccatacagtttgagttcgac
atggaaacggaccgatacaacaccatcgccgaggagatggcaaagtccggcataattttt
gaggacgacgccaaaactgtggcgcaactgctcaaggcccagatcacgcagataaccaag
gaacgcgaacagcaacgtacgaaagaaaaagaagcgctggctcaacaactacagtaccag
cagtacctgcagaagcaggccgaacaccagcaggcccaacaacaggcggccgccgctcaa
caacagcaggcctatcagcagcaggctcagccgcagcagcagcagggggcgccgccgcag
cagccgcaacaacaaccgcaggctcaaacccaacaggccccgccgcagtaccagcaagcg
gcgcagcccccgcagcaacccagtttccaacaggctcagccgcagtatgatccggtgcag
cagcagcagcagcaacagcagttccagcaacagtcgcagccgcagtacacgcagccgccg
cagcagtcgtatcagccgcagcagacgccgcaaccatccgccgatcagcagcaacagcct
cagtaccagcagcagccgatgcagatcgatcagaacgtgttgcagggccagtacgtgcaa
cagcaacaaccgcagcagcaggacgcccaggctttgttacagcatcagtaccagcagcag
caacagacgacaattatcccggaacagcaacagcagccgacacaacagcctccgccgcag
caaatctatcagcagccgcagcaggagcaaaccgtaacgccgccggtgttgcagaggcaa
accagcgtggatccggtgcaacagcagcccatcgtccacaagcaacagcaaccgccgcaa
cagtaccagcagtacataccggagggggcgttgccgcagcaggcggagttcttgcaggtg
caggagaatcagcagcataaaatctccagtgtgtcgcagccggacatgctgtgcgccact
tctagcacgtccgaaccgccgccgcaacatcgactcagcgtggacagtcagctggatatc
cacaatcagcagcagcaattccagcaacagttcagccaaccacagcaacagcaaccggac
tatcagacgcaaccgtatcagcaacaacaacccggtcaacaaccgcaaccgcagcaacag
taccaaccgttagggcaggaccagcaacaacaaacgtaccagcagagccagcccccgcaa
ccctatcaggtagcgcaagatcaaaattatcagcaacccacgcagcaacaaccgccgcct
acggctcaacaacccgcgtatcaaaatcaacagtcgcagccgtatcagcagccggcggct
cagtcctatcaggcgcagccgccaccgcaaccttatcaacaggagcagagctatcagcct
cctcccgccacgtatcagccggccccccagcaacaacagcctccacagcaaccgtatcag
caacagaccagtcaggacatggctcagaactacgtacagccacagacctaccagcagcag
ccccaacagccgacctatcagcagcagcaaccccagccctacccacagcaacctcccaca
tacacgccgcagcaacaacaacagcaacagtacgtggctccgcccccacaacaacaacag
ccgcagcagcaggatcagtctcagcagcaggtgtaccagcaacagcagttcatggcgcca
ccgcagcaacaaccgccgaccgctcagccgcagcccgtcgtggaacagttacagcaaccg
cagcccatctaccaacagccacagcaaattccccagccacaacctcagacttacgttcag
ccggcccaggcctacgtcgaaccgccaccccagcaacagcagcaacaagtttaccttccg
gttgaacacctccccgatcaacccgccccacctttgggacatccgtccgtctaccacgga
gctgccccacgtcctgccgcctaa

DBGET integrated database retrieval system