KEGG   Aethina tumida (small hive beetle): 109604989Help
Entry
109604989         CDS       T06105                                 

Definition
(RefSeq) interleukin-1 receptor-associated kinase 4-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    109604989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109604989
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109604989
Protein kinases [BR:atd01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109604989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death_2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109604989
NCBI-ProteinID: XP_019877105
Position
Unknown
AA seq 566 aa AA seqDB search
MPVPVVNSTLQLRKLNLRLQRQLETILDSDDLWKQLMCAIPKSLDVDPSMSKISEKNPPK
YNTEHFKIIESVSVKDHRSCTNILLDEWGTSGKVLPTLGHLFYLLKEAGIYRAGDLVADL
MGVPRPERPQLGPDAAVKIEDVNPTDLPVVGHLQRLHFGNEDPSLDSLLSDGTDVSKSIP
IKNLPNLPIFQLTTEASAQYLPQLPEVDIKYTSNAPITPLLEASVPNLQIFQSSTLMSSE
ENNSQLKCPSPLPSLSLNTSLPHISYVNLARCTNNFNTHPFTSKENSGRYLGHGTFGQVF
VAFDLMKQPVAIKKLNLDIVNMNKMEEVTKQFCNEVETLSKFKHDHLLELLGYSHDGSTY
CLAYEYMSGGTLHDKLKAQKGRLHWKERLDISLGLSQAITYLHTQFKDPVVHRDIKSPNI
LLDGSNKAKLGDFGLVRNLYNRTSTFTSAIGTSAYMSDEALRGEISYKMDTYSFGIVLLE
LLTSLPVTDENRQEVCLNEHAEYQYSIDGNGCNLLDRNEEVGDWLTKEVDIGEKLIEIAL
KCLKKKKIRPHQKEVTENLLDLAKYM
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtaccagttgtgaattcaacactgcaattgagaaaattaaatttaaggctccaa
agacaattggagacaatactcgatagtgacgacttgtggaaacaattaatgtgtgcaata
ccaaaaagtttagacgttgatccctcgatgtccaagatatcagagaagaatcctcccaaa
tacaatacggagcacttcaaaatcattgagagtgtatcagtgaaagaccaccgttcatgc
accaacatacttttggatgaatggggcacctcaggcaaagtgcttccaacactaggtcat
ctgttttacttgttgaaggaagcaggtatttatagagctggggacctggttgctgattta
atgggtgtgccgagacctgaaaggcctcaattaggtccggatgctgccgtcaaaattgaa
gatgtaaatcctactgacctaccggtagtcggtcaccttcaaagactgcactttggaaat
gaagatcctagcctggactcgcttctaagtgacggtacggatgtgtccaaatccattcct
ataaaaaatcttcccaatttgcccatatttcaactaacaacagaagccagtgcccaatat
ttgcctcagttgcccgaagttgacatcaaatatacttcaaatgcaccaataacaccacta
ctagaagcgtctgtgcctaatttgcaaatttttcaaagctctacgctgatgtccagtgaa
gagaataattcccagttgaagtgcccaagccctctacctagtctatccctcaacacctct
ttaccccacatctcatacgtaaatctggcaagatgcacaaataatttcaacactcacccc
ttcacaagcaaagaaaactctggacgttatttgggacatggaactttcgggcaagtcttc
gtggccttcgacttgatgaaacaacctgtggcaataaaaaaattaaacttggatatagtg
aacatgaacaaaatggaagaggttacaaagcaattctgcaacgaagtcgaaacgctaagc
aaatttaaacatgaccatttgttggaactcctcgggtattcacatgacggatccacctat
tgccttgcttatgagtacatgtccggaggcactttacacgacaaacttaaagcacaaaag
ggtagattgcactggaaggaaagattggatatatcgttgggtttgtcccaagccattact
tacttgcacactcaatttaaagatcctgtggtgcacagggacataaagagtcctaatata
ctgcttgatggaagcaacaaggcgaagttgggcgactttggactggttaggaatttatat
aatcgtacaagcaccttcaccagtgccataggaacgtctgcttacatgtcagacgaggcc
ttaagaggggaaatttcttacaaaatggacacgtacagttttggcattgtcttacttgaa
ttactgacctctttaccagtcacagacgagaacagacaagaagtttgtttaaatgagcat
gcagaatatcagtacagtattgatggaaatggctgtaatttattggataggaatgaagaa
gttggtgattggttaactaaggaagtggatattggagaaaagttaatcgagatagctctg
aaatgtttgaagaaaaagaaaatacggcctcatcagaaggaagtcaccgaaaacctttta
gatttagcaaaatacatgtag

DBGET integrated database retrieval system