KEGG   Aethina tumida (small hive beetle): 109608310Help
Entry
109608310         CDS       T06105                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
atd  Aethina tumida (small hive beetle)
Brite
KEGG Orthology (KO) [BR:atd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atd01001]
    109608310
Enzymes [BR:atd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109608310
Protein kinases [BR:atd01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   109608310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Choline_kinase
Motif
Other DBs
NCBI-GeneID: 109608310
NCBI-ProteinID: XP_019880286
Position
Unknown
AA seq 352 aa AA seqDB search
MNSLRQNPRTPKKTPITDDYDITKRVLGLGINGKVVECSSKATGEKYALKILVDSVKARR
EMELHWQASGCIHIVNIIDVYSNKYNNNSCLLMVMECMEGGELFQRIQDQPEGAFTEREA
AQVMHEICIAVKYLHDLNIAHRDLKPENLLYSRKDTHGVLKLTDFGFAKETSVQNTLQTP
CYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQ
YTFPDPEWKNVSEDAKELINGMLNVDPAKRLTIEQVMHNRWIAQYTAVPQTPLHTNKMLK
EGVETWPEVQEEMTRSLATMRVDYDQVQIKTLENSSNPLLNKRRKKAGAVKS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgttacgacagaacccgcgtacgcctaaaaaaacacccattacggatgattac
gacataacaaaacgggtgttaggtttagggataaatggaaaagtggtggagtgttcgtcg
aaggcgaccggagagaaatacgcgttgaagatactggttgacagtgtcaaggcccgaagg
gagatggaactgcactggcaggcgagtggttgcattcacatcgtaaacataatcgacgtg
tattcaaataaatacaacaacaacagctgtttactgatggtcatggaatgtatggaaggt
ggggaactattccaaagaatacaggatcaaccagaaggcgcgttcactgaaagggaggcg
gcgcaggtgatgcacgagatatgcattgcagtgaaatacttgcacgatttgaacattgca
cacagagatctgaagccggagaatttgctgtattcaagaaaggatactcacggtgtactt
aaactgaccgacttcggatttgccaaagagaccagtgttcaaaacacattacagacacca
tgctatacaccttattatgttgcgccagaagttctgggccccgaaaaatacgacaagagc
tgtgatatttggtccttgggtgtgataatgtacatccttttgtgtggttatccgccgttc
tacagcaaccacggcctagcgatctccccgggcatgaagaccaggatccgcatgggccag
tacacgttccccgatccggaatggaagaacgtcagcgaggacgccaaggaactgatcaac
ggcatgctgaacgtcgatccggccaagcggctgaccatcgaacaagtcatgcacaacaga
tggatcgctcaatacacggcggtgccgcagaccccgctgcacacgaacaagatgctgaag
gagggcgtggagacgtggccggaggtgcaggaggagatgacccgttcgttggccacgatg
cgcgtcgactacgatcaggtgcagatcaaaacgttggagaactcgagcaatcccctgttg
aacaagcgccgcaaaaaggccggcgccgtcaagtcataa

DBGET integrated database retrieval system