KEGG   Caldicellulosiruptor bescii: Athe_0431Help
Entry
Athe_0431         CDS       T00857                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00300  Lysine biosynthesis
ate01100  Metabolic pathways
ate01120  Microbial metabolism in diverse environments
ate01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Athe_0431
Enzymes [BR:ate01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Athe_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACM59563
UniProt: B9MNN4
Position
491489..492880
Genome map
AA seq 463 aa AA seqDB search
MNDVKVMINKEIENLKDEIVNTTLKLIKIRSVEDTPAPNMPFGKGINDALLVCENLCKSL
GFETKNYDGYALEAVYGNQDEDVCVIGHLDVVPEGEGWSVPPYEGVVKDGKIFGRGAIDD
KGPTVAALYGMYVVKKLTQEGKISLKRKLRFVFGTNEEGGSKCLQYYFERAKYPTVGFTP
DADFPVIQGEKGFLVFELTKDVEDTFEIEGGQRPNMVPDKCRFEGSFDVQKAKEIISIKG
LNDKAEVFEEAGKTCIITKGVSAHGSLPFKGENAISYMFDILNDLWTKEDEFRRFIDFYN
NHIGFDVFGEKLSIGFEDEKSGKLVSNVGMIRKEKGRLVLTINVRYPVDTSYEEIENKVK
EVLQDYNIEYRLVTNVPPLYFEADHFLIRTLLEVYREFTNDDTQPLVIGGGTYARWAKNV
VAFGPNMPGDEEVAHQKDEYILIDRLILCSKIYANAIYRLAKE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatgtaaaagttatgataaataaagaaattgaaaatttaaaagatgaaatagtg
aatactactttaaagcttataaaaatcaggagtgttgaggatacacctgcaccaaatatg
ccgtttggcaagggaattaatgatgccctgcttgtgtgtgaaaatctatgcaaaagcttg
ggatttgaaacaaaaaactatgatggatatgcgcttgaggcggtctatgggaatcaggat
gaggatgtgtgtgttataggtcatttagatgttgtgcccgaaggggaaggatggagtgtg
ccaccttatgaaggggttgtaaaggacggtaaaatttttggacgtggcgcgattgatgac
aaaggtccgactgttgcggctctttatggcatgtatgtggttaaaaagcttacccaggaa
gggaagatttctcttaaaagaaagctaaggtttgtttttgggacaaacgaagagggtggc
tctaagtgtcttcagtattattttgaaagagcaaaatatccaactgttgggtttactcca
gatgctgattttcctgtcattcaaggtgaaaaaggttttctggtgtttgagcttacaaaa
gatgtggaagatacctttgaaattgagggtggacagcgacctaacatggtgcctgacaag
tgcaggttcgaaggcagttttgatgtccaaaaagctaaagaaattattagtataaaaggg
ctgaatgataaggcagaagtttttgaagaagctggtaagacatgtataattacaaaggga
gtttctgctcatgggagtctgcctttcaaaggtgaaaatgcaatatcgtatatgtttgat
attttaaatgatctttggacaaaagaggatgagtttagaagatttattgatttttataat
aatcatattggatttgatgtgtttggagaaaaactttcaatagggtttgaagatgaaaag
tcaggcaagcttgtgtcaaatgtcgggatgatacgtaaagaaaaaggcagacttgtcctt
acaataaatgttcgctatccagttgacacctcatatgaggagatagaaaataaagtaaag
gaagtgctgcaggattataatattgaatatcgtttggtgacaaacgttccccctctttat
tttgaagctgaccactttttaatcaggaccttgcttgaggtttacagagaatttacaaac
gacgatacacagccgcttgtgattggcggtggaacatacgcaaggtgggcaaaaaatgtg
gttgcttttggtccaaatatgccgggtgatgaagaagttgcccatcagaaagatgaatat
atccttatagataggctaatcctttgtagcaaaatctatgcaaatgctatttacaggctt
gcaaaagaatag

DBGET integrated database retrieval system