KEGG   Caldicellulosiruptor bescii: Athe_0458
Entry
Athe_0458         CDS       T00857                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00460  Cyanoamino acid metabolism
ate00500  Starch and sucrose metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Athe_0458
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Athe_0458
Enzymes [BR:ate01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Athe_0458
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-ProteinID: ACM59590
UniProt: B9MNR1
Position
complement(520269..521627)
AA seq 452 aa
MSLPKGFLWGAATASYQIEGAWNEDGKGESIWDRFTHQKGNILYGHNGDVACDHYHRFEE
DVSLMKELGLKAYRFSIAWARIFPDGFGTVNQKGLEFYDRLINKLVENGIEPVVTIYHWD
LPQKLQDIGGWANPEIVNYYFEYAMLIVNRYKDKVKKWITFNEPYCIAFLGHFYGVHAPG
IKDFKVAMDVVHNIMLSHFKVVKAVKENNIDVEVGITLNLTPVYFQTERLGYKVSEIERE
MVNLSSQLDNELFLDPVLKGSYPQKLFDYLVQKDLLETQKVLSMQQEVKENFVFPDFLGI
NYYTRAVRLYDENSNWIFPIRWEHPAGEYTEMGWEVFPQGLYDLLIWIKESYPQIPIYIT
ENGAAYNDKVEDGRVHDQKRVEYLKQHFEAARKAIENGVDLRGYFVWSLLDNLEWAMGYT
KRFGVIYVDYETQKRIKKDSFYFYQQYIKENS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgagtttaccaaaaggatttctgtggggtgctgcaactgcatcatatcagattgagggt
gcttggaatgaagatggaaaaggtgaatctatatgggacaggtttacacatcaaaaagga
aatattttatatggtcataatggcgacgttgcctgtgaccactatcataggttcgaagaa
gatgtctctcttatgaaagaacttggactaaaagcctacaggttttctattgcatgggcg
agaatttttccagatggtttcggtactgtgaatcaaaaaggtcttgagttttatgataga
ctcatcaacaagcttgttgaaaacggtattgaaccggttgtcaccatttatcactgggat
cttcctcaaaagctacaagacattggcggttgggcaaacccagaaattgtaaattattat
tttgaatatgcaatgcttatcgtaaaccgttataaagacaaagtaaaaaaatggataaca
tttaatgaaccttattgtattgcctttttgggacacttttatggagttcatgcaccagga
ataaaagactttaaagttgcaatggatgttgtgcacaacattatgctttctcattttaag
gttgtaaaagctgtaaaggaaaacaatattgatgttgaggtaggaattacactaaattta
actccagtttactttcaaacagagcgtcttggatataaggtaagcgaaattgaaagagaa
atggtaaacctcagcagccagcttgacaatgaacttttccttgatccagtactcaaagga
agctatccacaaaagctgtttgattaccttgttcaaaaagatttgttggaaactcaaaaa
gtattgagtatgcagcaggaagtaaaagaaaatttcgtttttcctgattttcttggtatc
aactactatacacgtgctgtcaggctttacgatgaaaattctaactggatatttccaata
agatgggaacatcctgcaggagagtacaccgagatgggctgggaagtgttcccacaagga
ctttatgatcttttgatttggattaaagaaagttacccacaaattccaatttatataaca
gaaaacggtgctgcttataacgacaaggtagaagatggaagagttcatgaccaaaagaga
gtggagtatttaaaacagcactttgaagcagcaagaaaggcaattgaaaatggagtggat
ttgcgaggttattttgtgtggtctttgttggacaatcttgaatgggcaatgggttataca
aaaaggtttggagttatatatgtggactatgaaacccaaaaaaggattaaaaaagacagc
ttctatttttatcagcagtatataaaggaaaactcataa

DBGET integrated database retrieval system