KEGG   Caldicellulosiruptor bescii: Athe_0552Help
Entry
Athe_0552         CDS       T00857                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00010  Glycolysis / Gluconeogenesis
ate00052  Galactose metabolism
ate00500  Starch and sucrose metabolism
ate00520  Amino sugar and nucleotide sugar metabolism
ate00521  Streptomycin biosynthesis
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01120  Microbial metabolism in diverse environments
ate01130  Biosynthesis of antibiotics
ate01200  Carbon metabolism
Module
ate_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Athe_0552
   00052 Galactose metabolism
    Athe_0552
   00500 Starch and sucrose metabolism
    Athe_0552
   00520 Amino sugar and nucleotide sugar metabolism
    Athe_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Athe_0552
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Athe_0552
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Athe_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACM59678
UniProt: B9MPB7
Position
621716..622666
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLTL
DDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGIIIDGKIYTGSHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTAFDAKRMGDSTGTAIVDRY
VKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRRLVYEKFYCKQVPMPKIIPAVL
GNDAGIIGAALLAKQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgacttgggaggaacaaacattgcagcaggaattgtggatgaa
gaagggaagattataaaaaaaggttctgtgccaacaggagcgcacagacattatacagag
attatgaaggatatggcagagctttctttaaatcttgtaaaggaatgtggacttacactt
gatgatattcattctgttggaattggaagtccaggtgcacctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtccctatgagagaagagatacaaaaa
tacattccaaagcctgttaacatagaaaacgatgcaaactgtgcagcatatggcgagtat
atagcaggcggtgcaaaaggcacaaggatttcggtaacaataactcttggcacgggaatt
ggtggtggaattataattgatggtaagatttacacaggttcgcaccatgcaggtgctgag
cttgggcatatggtgatttgtgttgacggtgagcagtgcacatgtggccgaaaagggtgc
tgggaagcgtatgcgtctgcaacagctcttattcgtatgacaagagaggctgcagcaaga
aatatcaatggtactatcatgaaacttgtaaatggcgatatttcaaagattgatgcaaaa
acagcttttgacgcaaagcgaatgggagacagcactggtacagcaattgttgacaggtat
gtaaaataccttgctgaaggccttgcaaacatctgcaatatatttgaacccgaagttata
tgtattggcggtggagttagcaaagaaggagagtatcttttagagcctgtgagaaggctt
gtatatgaaaaattctactgcaaacaggttccaatgcccaaaatcattcctgccgttttg
ggcaatgatgctggtataattggggctgcgcttttagcaaagcagctgtga

DBGET integrated database retrieval system