KEGG   Caldicellulosiruptor bescii: Athe_1200Help
Entry
Athe_1200         CDS       T00857                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00860  Porphyrin and chlorophyll metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01120  Microbial metabolism in diverse environments
Module
ate_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Athe_1200
Enzymes [BR:ate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Athe_1200
Exosome [BR:ate04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Athe_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACM60300
UniProt: B9MRJ6
Position
1292853..1293830
Genome map
AA seq 325 aa AA seqDB search
MEFKRLRRLRQTKALRELFYETRLYSKEFVFPLFIDDGKNVFERMPQLDGIVKVSVDRLQ
EALDEIKKADIGGVILFGVTSQKDEMGSYATKDDGAVQHAIRKIKEYSEDILVFADVCLC
EYTSHGHCGILKGDKIDNDKTIEVLSEIALSYAKAGADIICPSDMMDGRVAAIRKKLDSH
GFVYTPIIPYSAKFASSLYAPFRDVANSRPAFGDRKSYQMPYQNKREALREIEADILEGA
DAVIIKPALTSLDVISAAKEKFNIPIIAYNVSGEYAMVKSAGKLGFLNEEEVIIEILTAI
KRAGADAIITYHALEAARILNRKEL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaaagattaagaagattaagacagacaaaggctttaagagaacttttttat
gaaacaagactttacagcaaagagtttgtttttcccctttttatcgatgatggtaaaaac
gtgtttgaaagaatgccgcaattagatggcattgtaaaggtatctgttgacagactacaa
gaagccttggatgagatcaagaaagctgacattggcggtgtaattttatttggtgtgact
tcacagaaagatgagatgggcagttatgctaccaaggatgatggggcagtccagcatgca
ataaggaaaataaaagaatattccgaagatatattggtgtttgcagatgtgtgcctttgt
gagtatacatctcatggacattgcggtattttgaaaggtgataaaatagacaatgataag
acaatagaagttttaagtgaaatagcactgtcctatgcaaaagcaggggcagatattatt
tgtccatctgatatgatggacggaagggttgctgctatccgcaaaaaacttgacagtcac
ggatttgtttatactcccatcataccatacagtgcaaagtttgcatcctcactttatgca
ccatttagagatgtagcaaactcacggcctgcttttggcgacagaaaaagttatcaaatg
ccataccaaaacaaaagagaggctttgcgagagatagaagctgacattttagaaggcgcc
gatgcagtaattataaaacctgccttgacatcacttgatgtaatttctgctgcaaaagag
aaattcaatattcctattatagcatataatgtaagcggcgagtatgctatggtaaaaagt
gctggcaagcttggttttttgaatgaagaagaggttataattgagatattgactgctata
aagagagcaggtgctgatgcgattataacataccatgctttagaggctgcaaggatattg
aatagaaaggagctttaa

DBGET integrated database retrieval system