KEGG   Caldicellulosiruptor bescii: Athe_1319Help
Entry
Athe_1319         CDS       T00857                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00620  Pyruvate metabolism
ate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Athe_1319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ate02000]
    Athe_1319
Enzymes [BR:ate01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Athe_1319
Transporters [BR:ate02000]
 Other transporters
  Primary active transporters [TC:3]
   Athe_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like His_biosynth TAL_FSA PHP
Motif
Other DBs
NCBI-ProteinID: ACM60419
UniProt: B9MRW5
Position
1407170..1408561
Genome map
AA seq 463 aa AA seqDB search
MGVKITETILRDAHQSLIATRMTTEQMLEIAPVLDQVGYYSVECWGGATFDACLRFFNED
PWERLKRLRTAFKKTKLQMLLRGQNLVGYRHYSDDVVEEFVKKAIYYGIDIIRIFDALND
IRNIEMALKITKKEKGHAQVAISYTVSPYHTIENYVNLAKQIEELGADSICIKDMAGLLS
PFDAYKLVKALKEQVKLPIHLHTHYTTGFGSMTYLKAVEAGVDGIDTALSPLALGTSQPP
TETIVYALENTEYAPKLDLEKINEASEYFKVLREEYIRKGLLDPKVLSVDINALHYQIPG
GMLSNLISQLKEQGQEDKLDEVLKEVPEVRKDFGYPPLVTPTSQIVGTQAVLNVIAGERY
KLVTKETKAYFKGEYGKPPAPVNEEVKRKILKDEKEITCRPADLILPELENAKEKIKEYI
ENDTDVVTYCLFPQLAENFFKLRFAKKYKVDADLVQGNKVYPV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgggggtaaaaataacagaaacaatactcagagatgctcatcagtcactcattgcaacc
cgcatgacaactgaacagatgcttgagattgctcctgtgcttgaccaagttggttattat
tcggttgagtgctggggcggtgctacatttgatgcgtgtctgaggtttttcaatgaagac
ccatgggaaagattaaaaagactgagaactgcttttaaaaagacaaagctccagatgctt
cttcgaggacaaaatcttgttgggtatagacattattctgatgatgttgttgaagagttt
gtaaaaaaggccatatactatggcattgatattataagaatatttgatgcacttaatgac
atccggaatattgaaatggctctaaaaataacaaaaaaagaaaaaggacatgcccaggtt
gccatatcatacactgtctcaccttatcatactattgaaaactatgtaaatttggcaaaa
caaatagaagaacttggggcagactcaatttgtataaaagacatggctgggcttctctct
ccatttgatgcttataaacttgtaaaagcgttaaaagagcaggtaaaacttcctattcat
cttcatacacactacaccacaggatttggatcaatgacatatttgaaagctgtcgaagca
ggtgtggatggtattgacacggctttatctccgcttgcactgggcacatcccagcctcca
accgaaacaattgtatatgcacttgaaaatacagaatatgctccaaaacttgatttagaa
aagatcaacgaggcaagcgaatattttaaagtactcagagaagaatatataagaaaaggg
cttcttgacccgaaagtattaagtgttgatataaacgctcttcattatcaaatacctggt
ggaatgctatcaaatcttatttctcagctaaaagaacaagggcaggaagacaagttagat
gaggttttaaaagaggtacctgaggttcgaaaagattttggatatccgccacttgtaact
cctacgagtcaaattgtgggaacacaagctgttttgaatgttatagcaggtgagagatac
aaacttgtcacaaaagaaacaaaagcatattttaaaggtgagtatgggaaacctccagct
cctgtgaatgaagaggtaaaaagaaaaatcttgaaagacgaaaaagagataacctgcaga
cctgcagatttgattttgccagagcttgaaaatgcaaaagaaaagattaaggagtatatt
gaaaatgatactgatgtggtaacttactgtttattccctcaacttgcagaaaattttttc
aaattaaggttcgcaaaaaaatacaaggttgacgctgatcttgttcagggtaacaaagtg
tatcctgtgtaa

DBGET integrated database retrieval system