KEGG   Caldicellulosiruptor bescii: Athe_1478Help
Entry
Athe_1478         CDS       T00857                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00340  Histidine metabolism
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01230  Biosynthesis of amino acids
Module
ate_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Athe_1478
Enzymes [BR:ate01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Athe_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Zwilch SF-assemblin
Motif
Other DBs
NCBI-ProteinID: ACM60576
UniProt: B9MJR8
Position
complement(1560062..1561357)
Genome map
AA seq 431 aa AA seqDB search
MRILSSKQQIENYIETAKIRKWGNEEEIEQKVRRIISDVKDKKDEALLYYTRMFDCKGIC
LNELRVVQEEIERAYFECEKEDSDFINALNAAYKNIYEYHMRQKEESWFYTKNGSLLGQI
IIPLKKVGIYVPGGKGAYPSTVLMNSIPAKVAGVEKIIMVTPPDKNKSISKYTLAAAKIC
GIDEIYKVGGAQAVAALAFGTQIIPKVDKIVGPGNIYVATAKKLLFGYVDIDSVAGPSEV
MVIADGSANPKYISADLLSQAEHDPMARCILVTTSLQIAQEVSENVDKMLARFEHSVAFE
AIEKNGVIIVVDDLFEAAEIANIIAPEHLEICCNDAEKVLFKIRNAGAVFVGEYSPEPIG
DYIAGPNHVLPTSGTASFFSPLGVYDFVKRMSLIKYSKEQFLTDAPHAINIAQKEGFLFH
ANSLKVRLEDV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcttgtccagcaaacaacagattgaaaactacatagagacggctaaaataaga
aaatggggaaacgaggaagaaattgaacagaaggttcgcagaataatctctgatgtaaaa
gataagaaagatgaagcattgctttactacacccggatgtttgattgtaagggtatttgc
ttgaatgagctgcgagtggtccaagaagagattgaaagagcatattttgaatgtgaaaaa
gaagatagtgatttcataaatgctttgaatgctgcgtataaaaatatctatgagtatcac
atgaggcaaaaagaggaaagctggttttatacaaaaaatggatcgttacttggccagatt
attatacctcttaaaaaagtaggaatttatgttcccggtgggaaaggagcttatccttca
acagttttgatgaattcaattcctgcaaaagttgctggcgttgaaaaaataataatggta
actccacctgacaagaacaagagtatcagcaagtacactttggcagcagcaaaaatttgt
ggcattgatgagatttataaagtgggaggagctcaagcagttgcggcacttgcgtttggg
acacagattatccccaaggtagataagattgtgggaccaggaaatatctatgtagcaact
gctaaaaaattgttgtttggatatgtagatattgactcagtagcaggaccaagtgaagta
atggttattgcagatggttctgcaaatccgaaatacatttctgcagatttgctgtctcag
gcggaacacgaccccatggcaagatgtattttagtgacaacatctttacagatagctcaa
gaggtttctgagaatgttgataagatgcttgcaagatttgaacactcagttgcttttgaa
gctatcgaaaaaaacggtgtgataatagttgttgacgatctttttgaggctgctgagatt
gcgaatataattgcacctgagcacttagagatttgttgcaatgatgcagaaaaagtgttg
tttaagatcagaaacgctggtgcagtttttgtaggtgaatattcccctgaacctattgga
gactacatcgcaggaccaaatcatgtactgccaacatctggtacagcaagtttcttttct
cccctcggggtttatgattttgtcaagagaatgagtttaataaagtattcaaaagaacag
tttttgacagatgcaccacatgcaataaacatagcgcaaaaagaaggttttctctttcat
gcaaattcgttgaaggtgaggttagaagatgtttaa

DBGET integrated database retrieval system