KEGG   Caldicellulosiruptor bescii: Athe_1485Help
Entry
Athe_1485         CDS       T00857                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ate  Caldicellulosiruptor bescii
Brite
KEGG Orthology (KO) [BR:ate00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Athe_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACM60583
UniProt: B9MJS5
Position
1566136..1567134
Genome map
AA seq 332 aa AA seqDB search
MHNIPLNLLLIIILALTFDFINGFHDTANAIATSVSTRVLTPRTAIFMSAVFNFFGAMIN
TKVAKTIGHEIVDPKFVTQNLVLAAVIAAILWDLITWWWGIPSSSSHAIIGGLVGAAIAA
TKSLADINWIGFVKKIVLPLIVSPILGFVFGYLFMMILYILFAKVHPTIVNRYFSKFQIL
SAMWMAYSHGSNDAQKSMGIITMALVGSGILNEFVVPDWVKFTCALAMALGTSVGGWRII
KTMGIKIIKLAPINGFAAETGAALTIQFATHIGAPVSTTHVISSSIMGVGACKKFSAVRW
GVARNIVIAWVLTIPMCALLGAIISILISWIA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcataacataccacttaatttacttttaataatcattttagctctgacttttgacttt
ataaacggctttcatgacacggcaaatgctattgcaacatcagtttcaacaagagtgtta
acaccacgcactgccatatttatgtcagcagtttttaatttctttggtgcaatgatcaac
acaaaggttgcaaagacaattggccatgaaatagttgatccaaagtttgttacccaaaac
cttgtgcttgcggctgtaattgcggcaattttgtgggacttgattacatggtggtgggga
ataccttcttcctcatcacatgcaataattggtggtcttgtgggtgctgcaattgccgca
acaaaatcacttgccgatataaattggataggatttgtcaaaaagattgttcttcctttg
attgtctctcctatcttaggttttgtttttggatacctatttatgatgattctttacata
ttgtttgccaaagtacatccaacaattgtgaatagatacttttcaaagttccaaatactc
tctgcaatgtggatggcatatagtcatggttcaaacgacgcccaaaaatccatgggaata
ataactatggcgctggtaggcagtggaatcttaaatgagtttgttgtacctgactgggtt
aaatttacctgtgctctcgctatggctctcggtacatcagtaggtggctggcgaataatt
aaaacaatgggaataaagataataaaacttgcaccaataaacggctttgcagcagaaact
ggtgcagctttaacaatccagtttgcaactcatattggcgcaccagtttccaccactcat
gtcatctcatcctctattatgggggtaggtgcatgtaaaaagttttcagctgttagatgg
ggggttgcaagaaatattgttattgcatgggttttgacaattccaatgtgtgctctattg
ggagctatcatttctatactaatcagctggatagcataa

DBGET integrated database retrieval system