KEGG   Caldicellulosiruptor bescii: Athe_1538Help
Entry
Athe_1538         CDS       T00857                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00900  Terpenoid backbone biosynthesis
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Athe_1538
Enzymes [BR:ate01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Athe_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C YcaO
Motif
Other DBs
NCBI-ProteinID: ACM60636
UniProt: B9MJX8
Position
complement(1624007..1624867)
Genome map
AA seq 286 aa AA seqDB search
MKLKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDNIIVTTSSENIPT
DNKNHAYIAASLLKERFGVKQGVRIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
EQQLMEIGREIGADVPFCLVGGTALCEGIGEKVIKLKSAPQMNILIAKPEVYVSTQAVYE
ALDLSKIKKRPNIEAMISAIEEGNVKEIAKNLCNVLEVVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFGNKYNALKAAERLKVFIKEIILTTTCEGSGF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcaaggcttatgcaaaaatcaacttagcattggatgtgctttcgaaaagagaa
gatggctatcatgaaataagaactataatgcaaacagtggatttgtatgatataatcaat
attgaaaagatagaagaagacaacataattgtgacaacttcaagtgaaaatattccaact
gacaataaaaaccatgcatacattgcagcttcacttttaaaagagcgttttggcgtaaag
caaggtgtgagaatacatattgaaaagaacattccggtctctgcgggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagctaaatctttct
gagcagcagcttatggaaatcggaagagagattggtgctgatgttccattttgtttggta
ggcggcacagccctttgtgagggaattggcgaaaaggtgataaagctaaaatcagctcct
cagatgaatatcctcattgcaaagccagaggtatatgtttctacgcaggctgtgtatgag
gcattggatcttagcaagataaaaaagagaccaaacattgaagctatgatttcggcaatt
gaagaaggtaatgtaaaagagatagcaaagaatctttgcaatgttttagaggtggttaca
gtaaatcagtatccagtcataaacagagtcaaggacattatgagaaataacaatgctctt
gggacagttatgacaggaagcggaccagctgtatttgggatttttggcaacaagtataat
gctttaaaagctgcagagaggctcaaggtgtttataaaagaaattatcttgactacaaca
tgtgaaggtagcggattttag

DBGET integrated database retrieval system