KEGG   Caldicellulosiruptor bescii: Athe_1690Help
Entry
Athe_1690         CDS       T00857                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ate  Caldicellulosiruptor bescii
Pathway
ate00260  Glycine, serine and threonine metabolism
ate00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ate01100  Metabolic pathways
ate01110  Biosynthesis of secondary metabolites
ate01130  Biosynthesis of antibiotics
ate01230  Biosynthesis of amino acids
Module
ate_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Athe_1690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Athe_1690
Enzymes [BR:ate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Athe_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF627 BtpA
Motif
Other DBs
NCBI-ProteinID: ACM60784
UniProt: B9MKC6
Position
complement(1777454..1778224)
Genome map
AA seq 256 aa AA seqDB search
MNFIDERFERLKKEGKKAFIGYVTFGYPTFEETLWFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESCKACGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatagatgaaagatttgaaaggctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccaacttttgaagaaacactttggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatgga
gaaattattcaaaaagcttctataaaagctctcagtgaaggtgtcaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgttgtatgcaaac
acagtttacaaaaggggaattgatagattttttgaaagttgcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatattgaccttgtatcaatatcttctcttgagagagccaagatg
ataggtaggcagagccgtggttttttgtattgtgtttcaagaaaaggtgtgacaggtttc
aaagggcagattgatgataggatttttacttttctaaaagaactaaaaaccgttacctca
acacctttagcagttggatttggtataaagagtaaagaagatgtgcaaaagttcaaagac
cttgcagatggtattgtcattggaagtgcaataatcacaaagatagatgaaggaaaagac
aaacttgaagattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system