KEGG   Agrobacterium tumefaciens Ach5: Ach5_05780Help
Entry
Ach5_05780        CDS       T03816                                 

Gene name
pit
Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
atf  Agrobacterium tumefaciens Ach5
Brite
KEGG Orthology (KO) [BR:atf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Ach5_05780 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Rib
Motif
Other DBs
NCBI-ProteinID: AKC06357
UniProt: A0A1B9V4L2
Position
circular:complement(614459..615964)
Genome map
AA seq 501 aa AA seqDB search
MAIKPPPNMKPTLDKDLEKITRVEEATLHVTQQLAGLGAGVMFVVLAAIFAGAFVTGTAG
AVIIIAAVAIGAYMAINIGANDVTNNVGPAVGAKAMPLAAALIIAAICEIAGALITGGNV
VETISSGIINIQTIPDRTVFSWAMLSALLAAGLLVNISTWTKAPISTTHTVVGGVAGAGM
AAYGIRAVDWLSLGSIAFAWVLAPFISAAIAIALLAFIKEFIIYREDKIDAAKRWVPVLI
GIMTGVFTAYLIWVGLRQIVHVSLGHASGIGLLTGLVAWRLCVPIIRKQSVGLENRNQSL
RTLFQWPLVLAAGLMSFAHGANDVSNAIGPVVAIVRALHDEAVETSARAPLWVMLVGAFG
LSCGILLYGPRLIRLVGEQITKLNPMRAFCVSVATALTVLVASRFGLPVSTTHTAIGAVF
GVGFFREWYTQASRRRQELVQAGTSQIRRADRYLDNPSEIRRRYLVRRSHFMTIIAAWLV
TVPASATLAALLYWLMSFLFL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaagccgccaccgaacatgaagccgacgctcgacaaggatctcgagaagatc
acccgtgtcgaagaggcgacgctgcacgtcacgcagcagcttgccggccttggtgcgggg
gtgatgttcgttgttctggcggcgatatttgccggcgccttcgtcacgggtacggcgggc
gccgtcatcatcatcgcagccgttgccatcggcgcctatatggcaatcaacatcggcgcg
aacgatgtgacaaacaatgtcggcccggcggtcggcgccaaggcgatgccgcttgcagcg
gcactcatcatcgccgccatctgcgagatcgcgggtgccttgatcaccggcggcaacgtc
gtcgagaccatttccagcggcatcatcaacatccagaccattcccgaccgcaccgtgttt
tcctgggctatgttgtcggcccttctcgccgccggtcttctcgtcaatatctcgacctgg
acgaaagcgccgatttccaccacccatacggtggttggcggcgttgcgggggctggaatg
gcggcctatggcatccgggcagtcgactggctgtcgcttggcagcatcgcctttgcctgg
gttctagcgccctttataagcgcggccatcgccatcgccctccttgccttcatcaaggaa
ttcatcatctaccgggaggacaagatcgacgccgcgaagcgttgggttcctgttctgatc
ggcatcatgaccggggtcttcaccgcttatctcatctgggtggggctgaggcagatcgtg
catgtctcgcttggccatgcaagcggcatcgggcttttgaccggcctcgtcgcctggcgg
ctgtgcgtgccgatcatccgcaaacaatcggtgggattggaaaaccgcaaccagtcgctt
cgaaccctgttccagtggccgctcgttcttgcggctggcctcatgtccttcgcgcatggg
gcaaatgacgtttcgaacgccatcggcccggtggtggcaatcgtgcgggcactgcacgac
gaggcagtggagacgtccgcccgcgcgccgctctgggtgatgctggtcggcgcattcggg
ctttcctgcggtattcttctctatggcccgcgcctcatccgccttgtcggtgaacagatc
accaagctcaacccgatgcgcgctttctgcgtttccgtggctacggctctgacggttctc
gtcgcctcacgcttcggcctgccggtcagcaccacccatacggcgatcggcgccgtgttc
ggcgtcggcttcttccgcgaatggtacacgcaggcgtctcgacggcggcaggaactcgtc
caggccggcaccagtcaaatccgccgggccgatcgatatctggacaatccttccgagata
cgccgccgttatctcgtccggcgatcccacttcatgaccatcatcgccgcctggctggta
accgttcccgcaagtgctacgcttgcagcactgttatattggcttatgtccttcctcttt
ctctga

DBGET integrated database retrieval system