KEGG   Agrobacterium tumefaciens Ach5: Ach5_22230Help
Entry
Ach5_22230        CDS       T03816                                 

Gene name
gguA
Definition
(GenBank) multiple sugar transport system ATP-binding protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf02010  ABC transporters
Module
atf_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:atf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ach5_22230 (gguA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atf02000]
    Ach5_22230 (gguA)
Enzymes [BR:atf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Ach5_22230 (gguA)
Transporters [BR:atf02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216]
    Ach5_22230 (gguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 AAA_15 RsgA_GTPase AAA_23 Ploopntkinase3 MCM AAA_27 MMR_HSR1 AAA_30
Motif
Other DBs
NCBI-ProteinID: AKC07998
UniProt: A0A3G2DLD9
Position
circular:complement(2282291..2283829)
Genome map
AA seq 512 aa AA seqDB search
MANTILEMRNITKTFPGVKALENVNLKVKEGEIHALVGENGAGKSTLMKVLSGVYPAGTY
EGEIHYEGAVRNFRAINDSEDIGIIIIHQELALVPLLSIAENIFLGNEVASGGVINWQQT
FNRTRELLKKVGLKESPETLITDIGVGKQQLVEIAKALSKSVKLLILDEPTASLNESDSE
ALLNLLIEFRKQGMTSIIITHKLNEVRKVADQITVLRDGMTVKTLDCHQEEISEDVIIRN
MVGRDLEDRYPPRDVPIGETILEVKNWNVYHQQHRDRKVLHDINVTVRKGEVVGIAGLMG
AGRTEFAMSVFGKSYGHKITGDVLIDGRPVDVSTVRKAIDAGLAYVTEDRKHLGLVLNDN
ILHNTTLANLAGVSKASVIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVVLS
KWLFSNPDVLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRIYV
MNEGRIVAELPKGEASQESIMRAIMRSGEKNS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccaataccattctcgaaatgcggaacatcaccaagacgtttccgggcgtaaaagcg
cttgagaacgtcaaccttaaggtaaaggaaggtgagatccacgcgctcgttggcgagaac
ggcgctggaaagtcgaccttgatgaaggtcctttccggtgtttatcccgctggcacctat
gagggcgagatccactacgaaggtgctgtgcgaaattttcgcgccatcaacgacagcgaa
gatattggtatcatcatcattcaccaggagcttgcgcttgtaccgctcctgtcgattgcc
gaaaatattttccttggcaacgaggtcgcttcgggcggcgtcatcaactggcagcagacc
ttcaaccgtacccgcgaacttctgaagaaggtgggcctgaaggaatcgccggagacgctg
attacggatatcggcgtcggcaagcagcagctggtcgaaatcgccaaggcgttgtcgaag
agcgtgaagcttctcatccttgatgagccgaccgcctcgctcaacgagagcgattccgag
gctctgctcaaccttttgatcgagttccgcaagcagggcatgacgtcgatcatcatcacc
cacaagctcaacgaagtgcgcaaggtggccgaccagatcaccgtgctgcgcgacggcatg
acggtgaagacgctcgactgtcatcaggaagaaatcagcgaggacgtcatcattcgcaac
atggtgggacgcgatctagaagatcgttatccgccgcgcgacgtgccgatcggcgagacc
attctcgaagtgaagaactggaacgtctatcaccagcagcaccgcgaccggaaggtcctg
cacgacatcaacgtcaccgtgcgcaagggcgaagtcgtcggcattgccgggctgatgggg
gcagggcgcacggaattcgccatgagcgtgttcggcaagtcctacggtcacaagatcacc
ggtgacgttctgatcgacggcaggcccgtggatgtcagcaccgtgcgcaaggcaatcgat
gccggtcttgcctatgtgaccgaagaccgcaaacatctcggtctggtgctcaacgacaac
attctgcacaacaccacgcttgccaatctggcaggcgtgtcgaaggccagcgtcatcgac
gacatcaaggaaatgaaggtggcgagcgatttccgcacacgccttcgcatccgctcttca
ggcatctttcaggaaacggtcaatctttcgggcggcaaccagcagaaggtcgtgctctcc
aagtggctcttctccaatcctgatgtcctgatcctcgacgagccgacacgcggtatcgac
gttggcgcgaaatacgaaatctacaccatcatcaaccagctcgctgccgacggcaaaggc
gttctgatgatctcatcggaaatgcctgaattgctcggcaattgcgaccgcatctacgtc
atgaacgaaggccgcatcgtcgctgaattgccgaagggagaggcgagccaggaaagcatc
atgcgcgctatcatgcgctcaggggagaagaactcatga

DBGET integrated database retrieval system