KEGG   Agrobacterium tumefaciens Ach5: Ach5_29300Help
Entry
Ach5_29300        CDS       T03816                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ach5_29300
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Ach5_29300
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Ach5_29300
    1.1.1.-  
     Ach5_29300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 ADH_N_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AKC08703
UniProt: A0A3G2DNE2
Position
linear:complement(239135..240208)
Genome map
AA seq 357 aa AA seqDB search
MKALRFHAAKDLRIEDVDMPPEPGSGEVLVENKFCGICGTDLHEYAYGPIFVPKEPHPFT
GAHGPQILGHEFGGVVKAVGEGVSHVKPGDRVSIQPLIMPRHGDYYADRGLYHLSTNLAL
AGLSWHSGGMAQAALLNDYNVQPIPDALSDQEAALIEPTAVAVYACDRGGVTAGSSVLVT
GAGPIGILVAMAARAAGASQIFLSDLNDTRLALARAALGEVRTINPKTEKVGDVIRAETE
GNVGCDVAIECVGNEYALKNCADAVRKQGVVVQTGLHPGENPLNWFDVTFKDIDIRGSWA
YPTHYWPRVARLIASGQIPASRIVTKNVSLSEAVTEGFDQLLDPAGKHLKILIDLSR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctttcacgccgccaaggacctacgcatcgaggatgtggatatgccg
cccgagcccggttcgggtgaggtgctcgtcgaaaacaagttctgcggcatctgcggcacg
gacctgcacgaatatgcctatggcccgatcttcgtgccgaaggagccgcatcctttcacc
ggcgcgcacgggccgcaaattctcggtcatgaattcggcggtgtcgtaaaggccgtaggc
gagggcgttagccatgtaaagcccggcgaccgggtatcgatccagccgctcatcatgccg
cgccatggcgactattatgctgatcgcggtctttatcacctgagcacaaatctcgctctc
gccggtctgtcctggcattccggcggcatggcgcaggccgctcttctcaacgactataac
gtccagccgatacccgatgcgctctccgatcaggaagcggccctcatcgagccgacggca
gtcgcggtttatgcctgcgaccgtggcggtgtcacggccggcagcagcgtgcttgtgacc
ggtgccgggccgatcggcattctcgtcgccatggcggccagggcggccggtgcctcgcag
atatttctttccgatctcaacgacacgcgtctggcgctggcgcgggcggcgcttggcgag
gtgcgcacgatcaatcccaagacggaaaaagtgggcgatgtcatccgcgccgagaccgaa
ggcaatgttggctgcgatgtcgccatcgaatgcgtcggcaatgaatatgcgctgaagaac
tgcgccgatgccgtgcgcaagcagggcgttgtggtgcagaccggcctccaccccggcgaa
aacccgctgaactggttcgacgtgaccttcaaggacatcgatatccgcggctcctgggcc
tatccgactcactactggccgcgtgttgcccggctgatcgccagcggccagatcccggcg
agccggatcgttaccaaaaacgtctcactcagcgaggcggtcacggaagggttcgaccag
ctgctcgacccggccggcaagcatctgaagatcctgatcgacctgtcgcgatag

DBGET integrated database retrieval system