KEGG   Agrobacterium tumefaciens Ach5: Ach5_39260Help
Entry
Ach5_39260        CDS       T03816                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00010  Glycolysis / Gluconeogenesis
atf00053  Ascorbate and aldarate metabolism
atf00071  Fatty acid degradation
atf00280  Valine, leucine and isoleucine degradation
atf00310  Lysine degradation
atf00330  Arginine and proline metabolism
atf00340  Histidine metabolism
atf00380  Tryptophan metabolism
atf00410  beta-Alanine metabolism
atf00561  Glycerolipid metabolism
atf00620  Pyruvate metabolism
atf00625  Chloroalkane and chloroalkene degradation
atf00903  Limonene and pinene degradation
atf01100  Metabolic pathways
atf01110  Biosynthesis of secondary metabolites
atf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ach5_39260
   00053 Ascorbate and aldarate metabolism
    Ach5_39260
   00620 Pyruvate metabolism
    Ach5_39260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ach5_39260
   00561 Glycerolipid metabolism
    Ach5_39260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ach5_39260
   00310 Lysine degradation
    Ach5_39260
   00330 Arginine and proline metabolism
    Ach5_39260
   00340 Histidine metabolism
    Ach5_39260
   00380 Tryptophan metabolism
    Ach5_39260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ach5_39260
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ach5_39260
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ach5_39260
Enzymes [BR:atf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Ach5_39260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKC09699
UniProt: A0A3G2DR47
Position
linear:1347236..1348765
Genome map
AA seq 509 aa AA seqDB search
MDATTKLDVKQEAAALLDRMGVARDLYNGGDMASFSPVTGEQIASLKTISVEGVAAVVDK
ADAAFKIWRNVPAPRRGELIRLLGEELRSFKADLGRLVSLEAGKVPSEGLGEVQEMIDIC
DFAVGLSRQLYGLTIATERPGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALALVCGNS
VVWKPSEKTPLTALAVQGIFERAVARFGDAPEGLSQLLIGDRAVGEALVDNPKVPLVSAT
GSTRMGRDVGPRLAKRFARAILELGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTTL
RRLFVHDSVYDQLVPRLKKAYASVSVGNPLETSALVGPLVDKAAFDGMQKALEAAKAHDG
VVNGGGRVDTGAPDAYYVKPALVEMPEQAGPVLEETFAPILYVMKYSDLDQAIDAHNAVA
AGLSSSIFTRDIQESERFLSSEGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDA
WKAYMRRATNTINYSKALPLAQGVSFDIE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgaccacgaagcttgacgtgaaacaggaagccgcggccctgctcgacagaatg
ggcgtcgcccgcgatctttataacggcggcgatatggcgtcgttcagcccggtaacgggt
gaacagatcgcaagcctcaagaccatttcggtcgagggtgtcgcagccgtggtcgacaag
gccgatgccgccttcaagatttggcgcaacgtgcctgctccgcgccgtggcgaactgatc
cggcttctgggcgaagaactgcgctccttcaaggcagatctcggtcggctcgtctcgctg
gaagcgggcaaggtcccgtccgaaggtctcggcgaagtgcaggagatgatcgatatctgc
gatttcgcggtcggcttgtcccgccagctttacggcctcaccatcgccaccgaacgcccc
ggccaccgtatgatggaaacctggcatccgctcggcgttgtcggcgttatctccgctttc
aattttccggtcgcggtctggtcgtggaacgcggcactcgcgctagtctgcggcaattcg
gtggtctggaagccatctgaaaagaccccgctgacggcacttgcggttcagggcatcttc
gaacgtgccgtagcccgttttggcgatgcgccggaagggctgtcgcagcttctgatcggc
gaccgcgccgttggtgaagcattggtggacaaccccaaggttcccctggtttctgcaacc
ggttccacccgcatgggccgcgatgtcggcccgcgtctggcgaagcgcttcgcccgcgcc
attctggaactgggcggcaacaatgccggcatcgtctgcccgtctgccgatctcgacatg
gcgctgcgcgccattgccttcggcgccatgggcacggccggccagcgctgcaccacgctt
cgccgtctcttcgtgcatgacagtgtttacgaccagctcgtgccgcgtctgaaaaaggcc
tacgcctccgtatccgtcggcaatccgctcgaaacatcggcgcttgtcggaccgctggtg
gacaaggcggctttcgacggcatgcagaaggcgctcgaagcggccaaggcgcatgacggc
gtggtgaatggcggcgggcgagtggatacgggtgcgccggatgcctattatgtaaagccg
gcacttgtcgaaatgcctgaacaggcggggccggtgttggaagagaccttcgcgccgatc
ctttatgtgatgaagtacagcgatctcgatcaggcgattgacgcgcataacgccgttgcc
gctggtctgtcgtcgtcgatcttcacccgcgacattcaggaatcggaacgtttcctgtct
tcggaaggctcggattgcggcatcgccaacgtcaatatcggaacctcgggcgcggaaatc
ggcggcgcattcggtggtgaaaaggaaaccggcggtggccgcgaatctggttcggatgca
tggaaggcctatatgcgccgcgccaccaacaccatcaactactccaaggcgctgcctttg
gcgcagggcgtttccttcgatatcgagtaa

DBGET integrated database retrieval system