KEGG   Agrobacterium tumefaciens Ach5: Ach5_41400Help
Entry
Ach5_41400        CDS       T03816                                 

Gene name
gatA
Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00970  Aminoacyl-tRNA biosynthesis
atf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ach5_41400 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:atf03029]
    Ach5_41400 (gatA)
Enzymes [BR:atf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ach5_41400 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ach5_41400 (gatA)
Mitochondrial biogenesis [BR:atf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ach5_41400 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKC09913
UniProt: A0A3G2DT15
Position
linear:1604815..1606212
Genome map
AA seq 465 aa AA seqDB search
MTDLIHLNTLEILALYGQKKLSPSEYWQAVEARIDAFEPTVNALYAYDPEDARKQALAST
TRWQKGETLGALDGIPVSLKELIATKGQPVPLGTKAVELVPALEDAPVAARCREDGAIIY
AKTTCPDYGMLSSGLSSFHKLSRNPWDPTQNPGGSSAGAASAGAAGYGTLHIGTDIGGSV
RLPAGWTGLFGFKPSQGRIPVDPYYTGRCAGPMTRTVVDAAYAMATLSRPDWRDGTALPP
NNINWMDLDIDVKGLRIGLMLDAGCGLALDDEVRDAVVASAKLFEDAGAIVVPVEPVLSR
DMLDGLDDFWRAKFWGDMAALSDERRAAILPYIHEWAQKGADVSGARAVFGFNQTMEMRK
ACGRLMQSVDVVISPVNPIVSYPADWASPTNDPERPFEHIAFTVPWNMSEQPASSINCGF
SKSGMPIGLQIVGPRYADLLVLKLSKAFEDWGGGVRHWPEPPKAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcatacacctcaacacgctcgaaatcctggcgctttacgggcaaaagaag
ctgtcgccatcggaatattggcaggcggtagaggcccgtatcgacgcattcgagcccacg
gtgaacgcgctttacgcctatgatcccgaggatgcccgcaagcaggcgctggcctcgacg
acgcgttggcaaaaaggtgaaacgctcggggccctcgatgggattccggtgtcgctgaag
gaattgatcgccactaaaggccagccggttccgcttggcaccaaagcggtggaactggtg
ccggccctggaagacgcgccggttgcggcccgctgccgcgaggacggcgccatcatttac
gccaaaaccacctgcccggattacggcatgttgtcatcgggcctttccagttttcacaag
ctcagccgcaacccgtgggacccgacacagaaccccggcggctccagtgccggtgcggct
tctgccggtgctgcgggttacggcaccctgcatatcggcacggatattggcggctcggtg
cggctaccggcggggtggacggggctgttcggcttcaagcccagccagggccgcataccc
gtcgatccctattataccggccgctgcgccggaccgatgacccgcaccgtcgtcgacgcc
gcctatgccatggccacgctttcccgcccggactggcgcgacggcaccgcgcttccgccc
aacaatatcaactggatggacctcgatatcgacgtaaagggcctgaggatcggcctgatg
ctggatgccggctgcggcttggccctggacgatgaggtgcgggatgctgttgtggcgtcc
gcaaagctgttcgaagatgcaggtgccatcgtggtcccggtcgagccggtgctgtctcgg
gacatgctggatgggctggatgatttctggcgggcgaaattctggggcgatatggcggcg
ctgagtgacgaacgccgcgcggcgatccttccctatattcacgaatgggcgcagaagggc
gctgatgtttccggcgcgcgtgccgttttcggtttcaaccagaccatggaaatgcgcaaa
gcctgcgggcggttgatgcagtcggttgatgtggtgatttcacccgttaatcccatcgtc
tcctatccggccgactgggcctcgcccaccaacgatcccgagcgacccttcgaacatatc
gccttcaccgtcccttggaacatgtcggaacagccggcatcctcgatcaattgcggtttc
tcgaaatccgggatgcccatcggcttgcagatcgtcggcccgcgttacgcggatctgctc
gttctcaagctttccaaggccttcgaggattggggcggcggtgttcggcactggccggag
ccgcccaaagcgcgctga

DBGET integrated database retrieval system