KEGG   Agrobacterium tumefaciens Ach5: Ach5_48330Help
Entry
Ach5_48330        CDS       T03816                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
atf  Agrobacterium tumefaciens Ach5
Pathway
atf00071  Fatty acid degradation
atf00072  Synthesis and degradation of ketone bodies
atf00280  Valine, leucine and isoleucine degradation
atf00310  Lysine degradation
atf00362  Benzoate degradation
atf00380  Tryptophan metabolism
atf00620  Pyruvate metabolism
atf00630  Glyoxylate and dicarboxylate metabolism
atf00640  Propanoate metabolism
atf00650  Butanoate metabolism
atf00900  Terpenoid backbone biosynthesis
atf01100  Metabolic pathways
atf01110  Biosynthesis of secondary metabolites
atf01120  Microbial metabolism in diverse environments
atf01130  Biosynthesis of antibiotics
atf01200  Carbon metabolism
atf01212  Fatty acid metabolism
atf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:atf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ach5_48330
   00630 Glyoxylate and dicarboxylate metabolism
    Ach5_48330
   00640 Propanoate metabolism
    Ach5_48330
   00650 Butanoate metabolism
    Ach5_48330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ach5_48330
   00072 Synthesis and degradation of ketone bodies
    Ach5_48330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ach5_48330
   00310 Lysine degradation
    Ach5_48330
   00380 Tryptophan metabolism
    Ach5_48330
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ach5_48330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ach5_48330
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ach5_48330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atf04147]
    Ach5_48330
Enzymes [BR:atf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ach5_48330
Exosome [BR:atf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ach5_48330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKC10600
Position
pAt:complement(240275..241441)
Genome map
AA seq 388 aa AA seqDB search
MRSYEDPIVILSAVRTPIGAFQGALKNYPAPQLGGIAIAEALKRAAVSADDVDELLMGCV
LPAGLGQAPARQAAHSAGLPWSVPCSTVNKVCGSGMKTIMMAHDGLANGTIGLAVAGGME
SMTNAPYLLEKYRGGARMGHGTVTDHMFLDGLEDAYDRGRSMGTFAEQTAEAYHFTRAEQ
DKYAMESLDRATTAISNGALREEIVAVGEFVADEQPEKARREKIPQLRPAFKEGGTITAA
SSASISDGAAAVVMTPMSGAEKLGSQPLAYIRGTASFAQAPGLFTTSPVFAIKGLLDRVG
WSVDDVDLFEVNEAFAVVPMVTMRDLRIPHEKLNVNGGACALGHPLGCSGTRVVATLLSA
LNTRGLKKGVASLCIGGGEATAVALEIF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcttatgaagaccccatcgtgatcctctctgcggtccgaacgcctatcggagcg
ttccagggcgcgctcaaaaactacccggccccgcaacttggcggcatcgccattgccgag
gccctcaaaagggcagcggtgagtgccgacgacgtcgacgagctgctgatgggctgcgtt
ctcccggcgggacttggtcaggctcccgcaaggcaggccgcccattcagccgggctgcca
tggtctgttccctgctcaaccgttaacaaggtgtgcggatccggcatgaagacgatcatg
atggcacatgacggccttgccaacggtaccatcgggcttgctgttgctggcggaatggaa
agcatgacgaatgcgccataccttctggaaaagtatcgtggcggcgcccgcatggggcat
gggacggtaacagaccacatgttcctcgacggtctcgaggatgcctatgaccgcggccgc
tcgatgggcacctttgcggaacaaacagcggaagcctaccatttcacgcgcgccgaacag
gacaagtacgcgatggagagtctcgacagggcaacgacagccataagcaatggcgcgctg
cgcgaggaaatcgtggcggtcggagagtttgttgccgacgagcagccggaaaaggcgagg
cgcgagaagatcccgcagctacgacccgcgttcaaggaaggcggaaccatcactgccgca
agttccgcatcgatatccgacggagcggctgcggtagtcatgacgccaatgtcgggcgct
gaaaagcttggctcgcagccactcgcctacatccgtggtacagcgagcttcgcgcaggca
cctggcctcttcaccacatctcccgtcttcgcaatcaagggattgctcgacagggttggc
tggagcgtggatgacgtcgatctgttcgaggtcaacgaggcctttgcggttgttcctatg
gtaaccatgcgcgaccttagaatcccccatgaaaagctcaacgtgaacggcggcgcctgc
gccttgggccacccactcggctgctccggaacaagagttgtcgctacgttgctctccgct
ctcaatacacggggcctcaagaaaggcgtggcttcactttgcataggcggaggagaagcc
acagctgtggcgctagaaattttctga

DBGET integrated database retrieval system