KEGG   Arabidopsis thaliana (thale cress): AT3G07370Help
Entry
AT3G07370         CDS       T00041                                 

Gene name
CHIP
Definition
(RefSeq) carboxyl terminus of HSC70-interacting protein
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G07370 (CHIP)
   04120 Ubiquitin mediated proteolysis
    AT3G07370 (CHIP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT3G07370 (CHIP)
   04131 Membrane trafficking [BR:ath04131]
    AT3G07370 (CHIP)
   04121 Ubiquitin system [BR:ath04121]
    AT3G07370 (CHIP)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT3G07370 (CHIP)
Chaperones and folding catalysts [BR:ath03110]
 Other chaperones and cochaperones
  Others
   AT3G07370 (CHIP)
Membrane trafficking [BR:ath04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    AT3G07370 (CHIP)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  U-box type E3
   AT3G07370 (CHIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U-box TPR_1 TPR_2 TPR_11 zf-NOSIP TPR_8 TPR_16 TPR_14 TPR_17 ANAPC3 TPR_9 zf-Nse
Motif
Other DBs
NCBI-GeneID: 819925
NCBI-ProteinID: NP_566305
MIPS: AT3G07370.1
TAIR: AT3G07370
Araport: AT3G07370
UniProt: Q9SRS9 A0A178VGJ7
Position
3
AA seq 278 aa AA seqDB search
MVTGVASAMAERLKEDGNNCFKKERFGAAIDAYTEAIALSPNVPAYWTNRALCHMKRKDW
TKVEEDCRKAIQLVHNSVKAHYMLGLALLQKKEFTNGVKELQRALDLGRCSNPTGYMVEE
IWEELSKAKYMEWELVSAMRSWELNSLKETCEAALNQQRALDMSRTEESSDEAYTAHTER
LKALERVFKKAAEEDKPTEVPDYLCCNITLEIFRDPVISPSGVTYERAAILEHLKKVGKF
DPITREKIDPANLVPNLAIKEAVAAYLEKHVWAYKMGC
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggttacaggcgtggcttccgccatggcggagcggttaaaggaagacggaaacaattgc
tttaagaaagaacgttttggtgctgccattgatgcttataccgaggcaatagctttgtct
ccaaatgttcctgcttattggaccaatcgagcactttgccacatgaagcgaaaggattgg
actaaggttgaagaggattgtcgcaaagctattcagcttgtccacaattccgtcaaggca
cactacatgctaggacttgcattattgcagaagaaagaatttactaatggagtcaaagaa
ttgcaaagggctttagatcttggaagatgctcgaatccaacaggatatatggtagaagaa
atatgggaagagctttctaaagcaaaatacatggagtgggaactggtttctgcaatgcgg
tcatgggaactgaatagtttgaaggaaacttgtgaggctgctcttaatcaacaacgtgct
ttagatatgtctcgaacagaagagtcctcagacgaagcatatactgcccatactgagcgt
ttgaaagctcttgaacgagtgtttaagaaagctgcagaagaagataaaccaactgaggtg
ccagattatttatgttgcaatataactcttgagattttccgagatcctgtaatttctcca
agtggggttacatatgaaagagcagcaatccttgaacatctcaagaaggtggggaagttt
gatcctataactcgtgaaaaaatcgacccggctaatctcgttccaaatctggctatcaaa
gaggcagtggcagcatatctagaaaaacacgtctgggcttacaagatgggttgttga

DBGET integrated database retrieval system