KEGG   Arabidopsis thaliana (thale cress): AT1G01040Help
Entry
AT1G01040         CDS       T00041                                 

Gene name
DCL1
Definition
(RefSeq) dicer-like 1
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G01040 (DCL1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     AT1G01040 (DCL1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    AT1G01040 (DCL1)
   microRNA pathway
    RISC loading complex
     AT1G01040 (DCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 PAZ Dicer_dimer dsrm Helicase_C DND1_DSRM ResIII DEAD
Motif
Other DBs
NCBI-GeneID: 839574
NCBI-ProteinID: NP_171612
MIPS: AT1G01040.1
TAIR: AT1G01040
Araport: AT1G01040
UniProt: Q9SP32 A0A178WCE6
Structure
PDB: 

Position
1
AA seq 1909 aa AA seqDB search
MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNESTDENGVINDFFGGI
DHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENGLQKNGGKRDEFSKEEG
DKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNWDEAGNNKKKRECNNYRR
DGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEER
KEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAILLIKSVHKDLMSQNRKMLSV
FLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRRWQREFESKQVLVMTAQILLN
ILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHTTPKDKRPAIFGMTASPVNLKG
VSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMPSEIVVEYDKAATMWSLHETIKQ
MIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYGVSERTESDGAANLIHKLRAINYT
LAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQESYLSEVVSLLQCELLEGAAAEKVA
AEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEVIGAAVADGKVTPKVQSLIKLLLKYQ
HTADFRAIVFVERVVAALVLPKVFAELPSLSFIRCASMIGHNNSQEMKSSQMQDTISKFR
DGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKTVLAYIQSRGRARKPGSDYILMVERGNV
SHAAFLRNARNSEETLRKEAIERTDLSHLKDTSRLISIDAVPGTVYKVEATGAMVSLNSA
VGLVHFYCSQLPGDRYAILRPEFSMEKHEKPGGHTEYSCRLQLPCNAPFEILEGPVCSSM
RLAQQAVCLAACKKLHEMGAFTDMLLPDKGSGQDAEKADQDDEGEPVPGTARHREFYPEG
VADVLKGEWVSSGKEVCESSKLFHLYMYNVRCVDFGSSKDPFLSEVSEFAILFGNELDAE
VLSMSMDLYVARAMITKASLAFKGSLDITENQLSSLKKFHVRLMSIVLDVDVEPSTTPWD
PAKAYLFVPVTDNTSMEPIKGINWELVEKITKTTAWDNPLQRARPDVYLGTNERTLGGDR
REYGFGKLRHNIVFGQKSHPTYGIRGAVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLM
MADGCMVAEDLIGKIVTAAHSGKRFYVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYK
QKYGVDLNCKQQPLIKGRGVSYCKNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLS
GSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASCQETFCYERAELL
GDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSR
WSAPGVPPVFDEDTKDGGSSFFDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSK
TLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFV
GLERALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLP
PGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSF
GLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQE
RCQQQAEGLEYKASRSGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIA
ESKEKHINNGNAGEDQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAH
AKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS
NT seq 5730 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggaggatgagcctagagaagccacaataaagccttcttattggctagatgct
tgcgaggacatctcttgtgatcttatcgatgatctcgtgtctgaatttgatccttcctct
gttgctgtcaatgaatccactgatgaaaacggcgtcatcaatgattttttcggtgggatt
gatcacattttagatagtatcaagaacggtggaggcttaccaaacaatggcgtttctgat
accaattctcaaatcaacgaggttactgtaactcctcaggttattgctaaggagacagtg
aaggagaatgggttgcaaaagaatggcggtaagagagacgaattctcgaaagaggaagga
gacaaggataggaagagagctagggtttgtagttatcagagtgaaaggagtaacctttca
ggtagagggcatgttaataattctagggagggagataggtttatgaataggaaacgtact
cgtaattgggacgaggcgggtaacaataagaagaaaagggaatgtaacaattacagaaga
gatggtagagatagagaagttaggggttattgggagagggataaagttggttccaatgag
ttggtttataggtcagggacttgggaagctgatcatgaaagagatgttaagaaagtgagt
ggtggaaaccgcgaatgcgatgtcaaggcagaggagaacaagagtaagcctgaagaacgt
aaagagaaggttgtggaagagcaagcaaggcgataccagttggatgttcttgaacaagct
aaagcgaaaaacacgattgctttccttgagaccggtgctggaaagacacttatcgcgatt
cttcttattaaaagtgttcataaggatctgatgagccagaacagaaaaatgctctcggtg
ttcttggttcccaaagtgcctttggtttatcagcaagcagaagtgatccgtaatcaaact
tgttttcaagttggacattattgtggtgagatgggacaggacttttgggattctcgaagg
tggcaacgagagtttgagtctaagcaggttctagttatgacagcacaaattctgttgaat
atactgagacacagtatcattagaatggaaacaattgatcttcttattctcgacgagtgt
caccacgctgtcaagaaacatccatactctttagtgatgtcagagttttaccatacaact
cctaaagataaaagacctgccatctttggaatgactgcttcgcctgttaatttaaagggt
gtttcaagccaagtagattgtgcgataaagatacgtaacctcgagaccaagttggattct
acggtttgtactataaaagatcgaaaagaattagagaaacatgtgcctatgccttcagag
atagtcgtcgagtatgacaaagctgctactatgtggtctcttcatgagacaataaagcaa
atgattgcagctgttgaagaagcggcacaagcaagttcaaggaaaagcaagtggcaattt
atgggggctagggatgctggagcaaaggatgaattgagacaggtttatggcgtctctgaa
agaacggagagcgatggtgctgccaatttgattcataaacttagagctatcaattatact
cttgctgaattgggtcaatggtgtgcttacaaggtgggacaatcattcttgtctgctttg
caaagtgatgagagggtgaatttccaagtcgacgtgaagtttcaagaatcatacctcagt
gaggtggtgtcactcttgcaatgtgagcttctggaaggcgctgctgctgaaaaagtcgcg
gcggaagttggcaaaccagaaaatggtaatgcacatgacgagatggaggagggagagctc
cctgatgatcctgtggtctcgggaggggagcacgttgatgaagtaataggcgccgcagtg
gctgatgggaaagttactccaaaagtacaatcattgatcaaactactcctcaaatatcag
cacacagctgattttcgagctattgttttcgttgagagggtggttgctgctttggttctt
cctaaggtttttgcggagctgccttcgcttagttttatacggtgtgccagcatgattgga
cacaataacagccaggagatgaaatcatctcaaatgcaggatacaatttccaaattccga
gatgggcatgtgacactgttagttgccacaagcgttgctgaggaaggacttgatattagg
caatgtaacgttgttatgcgtttcgaccttgcaaagacggtgctggcatacattcagtct
cgtggccgggcaagaaagcctggatcagactacatactcatggttgagagaggaaatgta
tctcacgcagcgttcctaaggaatgctaggaacagtgaggagacacttcgaaaagaagca
atagaaaggactgatcttagtcatctcaaagatacatcgagattaatctcaattgatgct
gtgcctggtacagtttataaggtggaggcaactggtgccatggttagcttgaattccgcg
gttggtcttgtacatttctactgctctcagcttcctggtgacaggtatgcaatccttcgt
cctgagtttagcatggagaagcatgaaaagcctgggggccacacggaatattcatgtagg
cttcagcttccttgcaatgcaccgtttgaaatacttgagggtcctgtttgcagttcaatg
cgtcttgcacaacaggctgtatgtttagctgcttgcaagaaactgcatgagatgggtgca
tttaccgatatgctattaccggacaaaggaagtggtcaagacgctgagaaggctgaccaa
gatgatgaaggtgagcctgttcctggaactgctagacatagagagttctatcctgaaggt
gtggcggatgtacttaagggagaatgggtttcatctggaaaggaagtttgtgagagctca
aagctattccatttatacatgtataatgtcagatgtgtagattttggctcttcaaaagat
ccattcctaagcgaagtttcagagttcgcgattctttttggcaatgagctggatgcagag
gtattatcgatgtctatggatctttatgttgctcgggccatgatcactaaagcatctctt
gctttcaagggatcacttgatattacagaaaaccagctatcatctctaaaaaagtttcat
gtgaggttaatgagtatcgtgttggatgttgatgttgaaccctccacgacaccatgggat
cctgcaaaggcctacctgtttgtccctgttactgacaatacgtctatggaacccataaaa
gggatcaactgggaattggttgaaaagattacgaaaaccacagcgtgggacaaccctctt
cagagagctcgtcccgatgtatatctcgggactaatgagagaactcttggtggggacaga
agggaatatgggtttggtaaacttcgtcacaacattgtatttgggcagaaatctcaccca
acttatggtattagaggagctgttgcatccttcgatgttgtgagagcttctggattgtta
cctgtgagagatgcttttgagaaggaagtagaagaggatttatcaaaaggaaaattgatg
atggctgatgggtgcatggttgcagaagatcttattgggaaaatagtgacagccgcacat
tccgggaagcggttttacgtagattcaatttgttatgacatgagtgcagaaacatctttc
cctaggaaagagggatatcttggtcccctagagtacaacacgtacgctgactattacaag
caaaagtatggagttgatttgaactgtaagcaacaacctttgattaaaggacgtggtgtt
tcgtattgcaagaaccttctttctcctcggtttgaacagtcaggtgaatctgagacagtc
cttgataagacatattacgtgtttcttccacctgaactatgcgttgtgcatccgctttcg
ggttcacttatccgaggtgctcagaggttaccctctataatgagaagagttgagagcatg
ttactcgctgttcaactcaaaaatttgattagttatcctattcccacatcaaagattctt
gaagccttgactgccgcctcgtgccaggaaacgttctgctacgagagagctgagctttta
ggagatgcgtatctaaaatgggttgttagtcgttttctgtttctcaagtatcctcaaaag
cacgagggtcagcttacaaggatgaggcaacaaatggttagtaatatggttctttatcag
tttgctctggttaaagggcttcagtcatatatccaggcggatcgattcgccccgtctagg
tggtctgctcctggtgtgcctccggttttcgacgaggacacaaaagatggaggatcttcg
tttttcgatgaagagcaaaaacctgtttccgaggaaaacagcgatgtgtttgaagatggg
gagatggaggatggtgaactagagggtgatttgagttcgtaccgagttttatctagcaaa
acgttagctgatgttgttgaggctttgattggtgtttattacgtcgaagggggtaagatt
gcagctaatcatttgatgaaatggattgggattcacgtggaggatgatcctgatgaagtc
gatggaacattgaaaaatgttaatgttccagagagtgtgctcaagagcatcgactttgtt
ggtcttgagagagctcttaaatatgagtttaaagagaaaggtcttcttgttgaagctata
acacatgcttcaagaccatcttcaggtgtttcgtgttaccagagattggaatttgttggt
gacgcggtcttggatcatctcatcacaagacatctatttttcacatacacaagccttcct
cctggtcggttaacagatcttcgagctgcagcggttaacaacgagaattttgctcgcgtt
gcggttaaacataaactccacttgtaccttcgtcacggttcaagcgccctcgaaaaacag
attcgggaatttgtgaaggaggttcaaaccgagtcatcgaaaccggggtttaactctttt
ggtttgggagactgcaaagcaccaaaagttcttggagacattgttgaatctattgcaggt
gctatttttcttgatagtggaaaagatacaactgctgcttggaaggtttttcaacctttg
cttcagcccatggtgacaccagagacacttccaatgcatccggtgcgagagctacaagag
cggtgccagcaacaagcagaagggttagaatacaaagcgagtaggagtggtaacacagcg
actgtggaagttttcatcgacggtgttcaagttggagtagcgcaaaacccgcagaagaaa
atggctcaaaagctagctgcgaggaacgcacttgcagctttgaaagagaaagaaatagca
gaatcaaaggagaagcatatcaacaacggtaatgcgggagaggatcaaggcgagaatgag
aatgggaacaagaagaatgggcatcagccgtttacgagacaaacgttgaatgatatttgt
ttgaggaagaattggccaatgccttcttacagatgtgtgaaagaaggaggaccggctcat
gcaaagagatttacgtttggggtaagagttaatacgagcgatagaggatggaccgatgag
tgtattggcgagccaatgccgagtgttaagaaagctaaggattcagctgcggttcttcta
cttgagcttttaaataaaactttttcttga

DBGET integrated database retrieval system