KEGG   Arabidopsis thaliana (thale cress): AT1G01080Help
Entry
AT1G01080         CDS       T00041                                 

Definition
(RefSeq) RNA-binding (RRM/RBD/RNP motifs) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM RRM_7
Motif
Other DBs
NCBI-GeneID: 839463
NCBI-ProteinID: NP_001030925
MIPS: AT1G01080.1
TAIR: AT1G01080
Araport: AT1G01080
UniProt: F4HQH8
Position
1
AA seq 294 aa AA seqDB search
MAASCFAIPLSSSSRSSHNAIPKYKTLISSSSYSYLESLKLQFSSSNSFHHSSLSRPFVA
QPLQIKVSSSELSVLDEEKEEEVVKGEAEPNKDSVVSKAEPVKKPRPCELYVCNIPRSYD
IAQLLDMFQPFGTVISVEVVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREM
RVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIV
STRVLHDRKTGRNRVFAFLSFTSGEERDAALSFNGTQYEGRRIIVREGIEKSES
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcctgcttcgcaattcccttatcttcttcttctcgatcgtctcacaatgca
attcccaaatacaaaaccctaatctcttcttcttcttactcttacttagaatctctgaaa
cttcaattctcttcttccaattcttttcatcactcttctctttctcgtccctttgtagct
caaccacttcaaatcaaggtctcttcttcagaattatcagttctcgatgaagaaaaagaa
gaagaagtagttaaaggagaagcagaacccaataaagatagtgtcgtctccaaagcagaa
ccagtaaagaaaccgagaccttgcgagctctacgtgtgtaatatccctagaagctacgac
attgctcagcttcttgacatgtttcagccttttggaactgtaatctctgtagaggtggta
tcgcgaaatcctcagacgggagagagccgtggaagcgggtacgtgacaatgggttctata
aactctgccaaaatcgccattgcttctcttgatggaacagaagtaggtggtcgggaaatg
cgggttaggtactctgttgacatgaatccaggaacaagaagaaaccctgaagtcttgaac
tcaactccaaagaagattctgatgtacgaaagccaacacaaggtctatgtcggaaatctc
ccttggttcacacagcctgatggtttgagaaaccactttagcaagtttggcacaatcgta
agcacgagagtgttacatgatcgtaagaccgggagaaacagagtctttgcctttctttct
tttacaagcggtgaagaacgtgatgcggctttatcattcaatggaacacaatatgaaggt
cgcagaatcatcgtcagagaaggtatcgagaagagtgagtcgtaa

DBGET integrated database retrieval system