KEGG   Arabidopsis thaliana (thale cress): AT1G01090Help
Entry
AT1G01090         CDS       T00041                                 

Gene name
PDH-E1_ALPHA
Definition
(RefSeq) pyruvate dehydrogenase E1 alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00020  Citrate cycle (TCA cycle)
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G01090 (PDH-E1_ALPHA)
   00020 Citrate cycle (TCA cycle)
    AT1G01090 (PDH-E1_ALPHA)
   00620 Pyruvate metabolism
    AT1G01090 (PDH-E1_ALPHA)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     AT1G01090 (PDH-E1_ALPHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N Transketolase_N
Motif
Other DBs
NCBI-GeneID: 839429
NCBI-ProteinID: NP_171617
MIPS: AT1G01090.1
TAIR: AT1G01090
Araport: AT1G01090
UniProt: O24457 A0A178W8A7
Position
1
AA seq 428 aa AA seqDB search
MATAFAPTKLTATVPLHGSHENRLLLPIRLAPPSSFLGSTRSLSLRRLNHSNATRRSPVV
SVQEVVKEKQSTNNTSLLITKEEGLELYEDMILGRSFEDMCAQMYYRGKMFGFVHLYNGQ
EAVSTGFIKLLTKSDSVVSTYRDHVHALSKGVSARAVMSELFGKVTGCCRGQGGSMHMFS
KEHNMLGGFAFIGEGIPVATGAAFSSKYRREVLKQDCDDVTVAFFGDGTCNNGQFFECLN
MAALYKLPIIFVVENNLWAIGMSHLRATSDPEIWKKGPAFGMPGVHVDGMDVLKVREVAK
EAVTRARRGEGPTLVECETYRFRGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENKL
AKEAELKSIEKKIDELVEEAVEFADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPK
FTEGTAQV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggctttcgctcccactaagctcactgccacggttcctctgcatggatcccat
gagaatcgtctcttgctcccgatccgattggctcctccttcttctttcctcggatccacc
cgttccctctcccttcgcagactcaatcactccaacgccacccgtcgatctcccgtcgtc
tctgtccaggaagttgtcaaggagaagcaatccaccaataataccagcctgttgataacc
aaagaggaaggattggagttgtatgaagatatgatactaggtagatctttcgaagacatg
tgtgctcaaatgtattaccgaggcaagatgtttggttttgttcacttgtacaatggccaa
gaggctgtttctactggctttatcaagctccttaccaagtctgactctgtcgttagtacc
taccgtgaccatgtccatgccctcagcaaaggtgtctctgctcgtgctgttatgagcgag
ctcttcggcaaggttactggatgctgcagaggccaaggtggatccatgcacatgttctcc
aaagaacacaacatgcttggtggctttgcttttattggtgaaggcattcctgtcgccact
ggtgctgcctttagctccaagtacaggagggaagtcttgaaacaggattgtgatgatgtc
actgtcgcctttttcggagatggaacttgtaacaacggacagttcttcgagtgtctcaac
atggctgctctctataaactgcctattatctttgttgtcgagaataacttgtgggccatt
gggatgtctcacttgagagccacttctgaccccgagatttggaagaaaggtcctgcattt
gggatgcctggtgttcatgttgacggtatggatgtcttgaaggtcagggaagtcgctaaa
gaagctgtcactagagctagaagaggagaaggtccaaccttggttgaatgtgagacttat
agattcagaggacactccttggctgatcccgatgagctccgtgatgctgctgagaaagcc
aaatacgcggctagagacccaatcgcagcattgaagaagtatttgatagagaacaagctt
gcaaaggaagcagagctaaagtcaatagagaaaaagatagacgagttggtggaggaagcg
gttgagtttgcagacgctagtccacagcccggtcgcagtcagttgctagagaatgtgttt
gctgatccaaaaggatttggaattggacctgatggacggtacagatgtgaggaccccaag
tttaccgaaggcacagctcaagtctga

DBGET integrated database retrieval system