KEGG   Arabidopsis thaliana (thale cress): AT1G01140Help
Entry
AT1G01140         CDS       T00041                                 

Gene name
CIPK9
Definition
(RefSeq) CBL-interacting protein kinase 9
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NAF Kinase-like Kdo KA1 APH
Motif
Other DBs
NCBI-GeneID: 839349
NCBI-ProteinID: NP_171622
MIPS: AT1G01140.1
TAIR: AT1G01140
Araport: AT1G01140
UniProt: Q9MAM1 A0A178W7T6
Position
1
AA seq 447 aa AA seqDB search
MSGSRRKATPASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQAAIKILDREKVFRHKM
VEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEAR
RYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFGLSAFSRQVREDGLLHTAC
GTPNYVAPEVLSDKGYDGAAADVWSCGVILFVLMAGYLPFDEPNLMTLYKRICKAEFSCP
PWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPPSFDQDDEDITIDDVDAAFS
NSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSK
MEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVFEVAPSLHVVELRKTGGDTLEF
HKFYKNFSSGLKDVVWNTDAAAEEQKQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagcagaaggaaggcgacgccggcgagtaggacgcgagtagggaattacgag
atgggacgaactctcggagaaggaagcttcgctaaggtgaaatacgccaagaacaccgtc
accggagatcaagccgctatcaaaatcctcgaccgagaaaaggtcttccgtcacaaaatg
gtcgaacagcttaaaagagaaatatctacaatgaaactgattaaacatccaaatgtggtt
gaaatcattgaggttatggcgagcaaaacgaagatctatatcgttcttgagcttgtcaat
ggaggtgaactctttgataaaatcgcgcaacaagggaggcttaaggaggatgaagctcgg
agatattttcagcagctcatcaatgctgtggattactgccacagtcgaggtgtctaccac
agagatctcaagcctgaaaatctgatccttgacgcaaatggggttttgaaagtctctgat
tttgggttaagcgccttctcacgacaagttcgggaagatggtttgcttcatacagcttgt
ggaacgccaaactacgttgcccctgaggttttgtcggacaaaggctatgacggtgcagca
gcagatgtctggtcttgtggtgtcattctctttgtgcttatggctggttacttgcctttt
gatgagccgaatctcatgacattatacaaacgtatatgcaaggctgagtttagctgccca
ccatggttctcgcaaggtgccaagagagtcatcaagcgtattctcgaacccaaccctatt
accagaataagtattgcagagttgctcgaagatgaatggttcaagaaagggtacaagccg
ccatcatttgaccaagatgacgaggacataaccatagatgatgttgatgctgcttttagt
aactccaaggaatgtcttgtaactgagaagaaggagaaacctgtatccatgaacgctttc
gaacttatctctagctcaagcgagttcagtcttgaaaacttgttcgagaagcaagcgcaa
cttgtgaagaaagaaacgcggtttacttctcaacgatctgcgagtgaaataatgtcgaaa
atggaagaaaccgcaaagccattaggctttaatgtccgtaaagacaactacaagataaaa
atgaaaggagacaaaagtggtcgtaaaggtcagctctccgtagctacagaggtgtttgaa
gtggcgccatcattgcatgtggtagagcttaggaaaaccggtggtgataccctcgagttt
cacaagttctacaaaaacttctcatctggattaaaggatgtagtctggaatactgatgca
gccgctgaagaacaaaagcaataa

DBGET integrated database retrieval system