KEGG   Arabidopsis thaliana (thale cress): AT1G01180Help
Entry
AT1G01180         CDS       T00041                                 

Definition
(RefSeq) S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_24 CmcI TylF
Motif
Other DBs
NCBI-GeneID: 839239
NCBI-ProteinID: NP_171626
MIPS: AT1G01180.1
TAIR: AT1G01180
Araport: AT1G01180
UniProt: A0A178W7N2 F4HS78
Position
1
AA seq 307 aa AA seqDB search
MKEDRRLPHKRDAFQFLKTKAAYVIVIVLTYAFGYFSAYHYHQPLQQQLPPSTTAVETTK
PQVCSIDNFRVTTPCGNLVPPELIRQTVIDRIFNGTSPYIDFPPPHAKKFLRPKRIKGWG
SYGAVFENLIRRVKPKTIVEVGSFLGASAIHMANLTRRLGLEETQILCVDDFRGWPGFRD
RFKDMALVNGDVLLMYQFMQNVVISDFSGSILPVPFSTGSALEKLCEWGVTADLVEIDAG
HDFNSAWADINRAVRILRPGGVIFGHDYFTAADNRGVRRAVNLFAEINRLKVKTDGQHWV
IDSVKVT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggatcgtcgtcttcctcacaaacgcgacgccttccaattcttgaaaaccaag
gctgcgtacgttatcgtcatagttctaacctacgcctttggttacttctccgcctaccac
tatcatcaaccgctgcagcagcagctgccaccgtctacgacagccgtggaaacgacaaaa
cctcaagtttgttcaatcgacaacttccgagttacgactccatgcggcaatcttgttccg
ccggaattgattcgccagactgttattgaccggatctttaacggaacttctccgtacatc
gatttcccaccaccgcacgccaagaagtttctccggccaaaaagaatcaaaggttgggga
tcatacggggccgttttcgagaatctaatccgccgagtcaaacctaagacgatcgtcgaa
gtcgggagttttctcggcgcgtcggcgatacacatggcgaatctcacgcgccgacttggg
ctcgaggagactcagattctatgcgtcgacgacttccgtggctggcccggttttcgagac
cggtttaaggacatggctttggttaacggtgacgttctgcttatgtaccagtttatgcaa
aacgtggttatctcggatttttccggttcgatattgccggttcctttctcgaccggttcg
gctttggagaagctgtgtgagtggggagtgacggcggacctggtggagatagacgcgggt
cacgattttaattcggcatgggcggatataaaccgggcggttcggatactccgacccggc
ggtgttatatttggtcacgattatttcacggcggcggataatagaggagtgaggagagcc
gtgaatctgttcgcagagattaaccggttaaaggtcaaaaccgatggtcaacattgggtt
attgattcggtcaaagtaacctga

DBGET integrated database retrieval system