KEGG   Arabidopsis thaliana (thale cress): AT1G60710Help
Entry
AT1G60710         CDS       T00041                                 

Gene name
ATB2
Definition
(RefSeq) NAD(P)-linked oxidoreductase superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 842365
NCBI-ProteinID: NP_564761
MIPS: AT1G60710.1
TAIR: AT1G60710
Araport: AT1G60710
UniProt: Q93ZN2
Position
1
AA seq 345 aa AA seqDB search
MAEACGVRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTS
DIYGPETNEVLLGKALKDGVREKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLD
IACIDLYYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQ
IEWSLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQE
ENLDHNKIVYEKVCAISEKKGCTPGQLALAWVHHQGDDVCPIPGTTKIENLKQNIGALSV
KLTPEEMTELEAIAQPGFVKGDRYSNMIPTFKNAETPPLSAWKAA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcttgcggagtgagaaggatgaagctgggaagccaaggccttgaggtatct
gcgcaaggccttggttgcatgggcctctccgctttctacggtgctcccaagccggaaaat
gaagccatcgctctcatccaccacgctattcactccggcgttactctccttgacacctcc
gatatctacggccctgagaccaatgaagttctcctcggaaaggctctcaaggatggggtg
agagaaaaagtggaacttgcgaccaaatttggaatcagttatgcagaggggaaaagagag
gtcagaggagatcctgaatatgtaagggctgcttgtgaggcaagtttaaagaggctagat
attgcctgcatcgatctctattatcagcatcgtgtcgatactcgtgtccctatcgaaatc
actatgggagaactgaagaagctggttgaagagggtaaaataaagtacattggtttgtct
gaagcctctgcctcaactatcagaagagcacatgctgttcacccaattactgccgtgcag
atagaatggtccttgtggacgagagatgtggaagaagaaatcattccgacctgcagggaa
cttgggattgggattgttgcttacagtcctctaggacgaggtttcttcgcatctggaccc
aagcttgttgagaacctagaaaaggatgacttcagaaaggctctaccaagattccaagag
gaaaacttagaccacaacaagattgtttatgaaaaagtttgtgcaatatcggagaagaaa
gggtgcactcctggacaactagccctggcatgggttcatcaccagggagatgacgtttgc
cctatcccaggaaccactaagatcgagaacctcaaacagaacattggagctttgtcagtg
aaactcactcctgaagagatgactgagcttgaggccattgcccaaccaggttttgtgaaa
ggagatagatacagtaacatgataccaactttcaagaacgctgagacaccaccattgtct
gcttggaaagccgcttaa

DBGET integrated database retrieval system