KEGG   Arabidopsis thaliana (thale cress): AT2G11810Help
Entry
AT2G11810         CDS       T00041                                 

Gene name
MGDC
Definition
(RefSeq) monogalactosyldiacylglycerol synthase type C
  KO
K03715  1,2-diacylglycerol 3-beta-galactosyltransferase [EC:2.4.1.46]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00561  Glycerolipid metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT2G11810 (MGDC)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.46  monogalactosyldiacylglycerol synthase
     AT2G11810 (MGDC)
Glycosyltransferases [BR:ath01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   AT2G11810 (MGDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glycos_transf_1 Glyco_trans_1_4 Epimerase_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 815657
NCBI-ProteinID: NP_565352
MIPS: AT2G11810.1
TAIR: AT2G11810
Araport: AT2G11810
UniProt: Q9SI93
Position
2
AA seq 465 aa AA seqDB search
MMKVVSPRTRSDSITEKVFRRVYSNFNISTVEDEYIHRQRSSDYEKESRLRKRGLEDKEE
VMEMEQMGAERIKTVLILMSDTGGGHRASAEAIRDAFKIEFGDDYRIIIKDVWKEYTGWP
LNDMERQYKFMVKHVGLWSVAFHGTSPKWIHKSYLSALAAYYAKEIEAGLMEYKPDIIIS
VHPLMQHIPLWVMKWQGLHKKVIFVTVITDLNTCHRTWFHHGVSRCYCPSKEVAKRALVD
GLDDSQIRVFGLPVRPSFPRTILNKNELRKELEIDLNLPAVLLMGGGEGMGPVQKTALAL
GDSLYNSKESNPIGQLIVICGRNKVLASTLASHEWKIPVKVRGFETQMEKWMGACDCIIT
KAGPGTIAEALICGLPIILNDYIPGQEKGNVPYVVDNGAGVFTRSPKETAKIVADWFSNN
KEELKKMSENALKLSQPEAVFDIVKDIHHLSQQQQRIPLFNEFSY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtggtgtcacctcgtacacggtcggattcaatcactgagaaggtgtttcga
cgagtctatagcaattttaacatctcaacagtagaagatgagtatatccatcgtcagaga
tcaagtgattatgagaaggagagtcgtctaaggaagagagggttagaagacaaagaagaa
gttatggagatggagcagatgggagcagagaggatcaaaactgttcttattctcatgagt
gataccggcggtggccaccgtgcttcagccgaggccatccgcgacgctttcaagatcgaa
ttcggagatgactatcggataatcataaaagatgtttggaaagaatacactggatggcca
ttgaacgacatggagagacagtacaagttcatggtgaaacatgttggtctttggtctgtt
gcgtttcatggtacttctcccaaatggatccacaaaagctatctaagtgctcttgccgct
tattatgccaaagaaatagaggccggtttaatggagtacaaaccggacattattattagc
gtgcatcctctgatgcaacacataccattgtgggtaatgaaatggcaaggacttcacaag
aaagttattttcgttacggtcatcactgatctaaacacttgccaccgtacatggttccat
catggagtcagcagatgttattgtccgtccaaagaggttgcaaagagagcattagtagac
ggccttgatgactctcaaatccgtgtctttggcttacctgtccgcccatctttccctcgc
actattctcaacaagaatgaactaaggaaggaacttgaaatagacttaaatttacctgcg
gttctattaatgggagggggtgaaggaatgggtccggttcaaaaaacagctctagccctt
ggagattctttatacaactctaaagaaagtaatccaataggacaattgattgtcatatgc
ggccggaacaaagtccttgcttctacattagcatctcatgaatggaagattccggtcaag
gttcgagggtttgaaacacaaatggaaaaatggatgggagcttgtgattgtatcatcact
aaggctggtccgggtacgattgcggaagcactgatttgcggcctcccaattatcctcaat
gactatattcctggacaggaaaaaggcaacgtgccgtatgttgtggacaatggggctgga
gttttcacccgaagtcccaaagaaactgcgaaaatcgtggcggattggtttagcaacaat
aaagaggaattaaagaaaatgtcagagaatgctctaaagttgtcgcaacctgaagccgtg
ttcgacattgtgaaggatatccatcatctatcccaacaacaacaacgtattccacttttt
aatgaattttcctattga

DBGET integrated database retrieval system