KEGG   Arabidopsis thaliana (thale cress): AT3G09980Help
Entry
AT3G09980         CDS       T00041                                 

Definition
(RefSeq) ankyrin repeat 30A-like protein (DUF662)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Transcrip_act HEPN_Toprim_N Suppressor_APC Baculo_PEP_C DUF948 DAGAT Exonuc_VII_L Phasin Spc7 SAM_KSR1 DUF4407 Laminin_II DUF16
Motif
Other DBs
NCBI-GeneID: 820159
NCBI-ProteinID: NP_187609
MIPS: AT3G09980.1
TAIR: AT3G09980
Araport: AT3G09980
UniProt: Q8RXZ8 A0A384LIF9
Position
3
AA seq 178 aa AA seqDB search
MKEMQAIETSQPTTVAPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEI
EKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVAMVRKKIDSVNKELKPL
GHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESEKMRMKKLEELSKNIDSIH
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagatgcaggcaatagagacgtcgcagccgacgacggtggctccggcggtgcat
agccgacaattgggagctcagttgtcgggaagtatgagtttcagcagccaaatgtcgaag
gaagatgaggagatgtctagaactgcgttatctgcgtttagagcgaaagaagaagagatc
gagaagaagaagatggagattagggaaagggttcaagctcagcttggtcgtgtcgaagaa
gagactaagcgtcttgctttgatccgtgaggaacttgaaggattagctgatcccatgagg
aaagaagttgctatggttaggaagaagattgattctgtcaacaaagaattaaagccattg
ggccatacagttcagaaaaaggaacgagagtacaaagaagctcttgaagcattcaacgaa
aagaacagggagaaggtgcagctaatcaccaggctaatggagttggtgggagaaagcgaa
aagatgagaatgaagaagctggaagagctaagcaagaacatagattctatacactga

DBGET integrated database retrieval system