KEGG   Arabidopsis thaliana (thale cress): AT3G58790Help
Entry
AT3G58790         CDS       T00041                                 

Gene name
GAUT15
Definition
(RefSeq) galacturonosyltransferase 15
  KO
K20867  galacturonosyltransferase 12/13/14/15 [EC:2.4.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ath01003]
    AT3G58790 (GAUT15)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AT3G58790 (GAUT15)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Structural polysaccharide
   AT3G58790 (GAUT15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Motif
Other DBs
NCBI-GeneID: 825048
NCBI-ProteinID: NP_191438
MIPS: AT3G58790.1
TAIR: AT3G58790
Araport: AT3G58790
UniProt: Q8L4B0 W8QNJ3 A0A384KHQ7
Position
3
AA seq 540 aa AA seqDB search
MKFYISATGIKKVTISNPGVGIGKGSGGCAAAAAALAARRFSSRTLLLLLLLLAIVLPFI
FVRFAFLVLESASVCDSPLDCMGLRLFRGGDTSLKIGEELTRALVEETTDHQDVNGRGTK
GSLESFDDLVKEMTLKRRDIRAFASVTKKMLLQMERKVQSAKHHELVYWHLASHGIPKSL
HCLSLRLTEEYSVNAMARMRLPPPESVSRLTDPSFHHIVLLTDNVLAASVVISSTVQNAV
NPEKFVFHIVTDKKTYTPMHAWFAINSASSPVVEVKGLHQYDWPQEVNFKVREMLDIHRL
IWRRHYQNLKDSDFSFVEGTHEQSLQALNPSCLALLNHLRIYIPKLFPDLNKIVLLDDDV
VVQSDLSSLWETDLNGKVVGAVVDSWCGDNCCPGRKYKDYFNFSHPLISSNLVQEDCAWL
SGMNVFDLKAWRQTNITEAYSTWLRLSVRSGLQLWQPGALPPTLLAFKGLTQSLEPSWHV
AGLGSRSVKSPQEILKSASVLHFSGPAKPWLEISNPEVRSLWYRYVNSSDIFVRKCKIMN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttacatatcagcgacggggattaagaaggttacgatatcaaatcccggcgtc
ggaatcggtaaaggaagcggaggatgtgcggctgcagcggcggcgttagcagcgcggaga
ttctctagtcgcacgttgttactgttgctgctgctgctcgctatcgtcctcccttttatc
ttcgtcaggttcgcgtttctcgtcctcgaatctgcctccgtttgcgattcaccactcgat
tgcatgggactcagacttttccgtgggggcgacacatctctgaaaattggggaagagttg
acacgggctctagtggaagagacgacagatcatcaggacgttaatggaagaggaacgaag
ggatcattggagtcattcgacgaccttgttaaggagatgacgttaaaacgccgtgacata
agggcgtttgcttccgtgactaagaagatgctgttgcagatggaacgtaaagtccaatca
gcgaaacatcatgagttagtgtactggcatttagcctctcacggtattcctaaaagcctc
cattgcctttccctcagattaactgaagagtactctgtaaatgcaatggctcgaatgcgt
ttgcctccgcctgagtccgtatcacgtctgaccgacccatcttttcatcatattgtcctc
ctgactgacaatgtccttgctgcctctgtcgtcatatcgtctactgtacaaaacgctgtg
aatcccgagaagtttgtctttcatattgttaccgataagaaaacctatacccctatgcat
gcttggtttgctatcaactctgcttcatcaccagttgttgaagtaaagggacttcatcag
tatgattggcctcaagaagtgaacttcaaagttagagagatgctggacattcaccgctta
atttggagacgacattatcaaaatttgaaagactctgattttagttttgttgagggtact
catgagcagtccttgcaagctctaaatcctagctgccttgcccttttgaaccatcttcgc
atttacattcccaagctttttccagatctcaacaagatagtgttgttggatgatgatgta
gtagtacagagcgatctttcgtctttatgggaaacggatctcaacggtaaagttgttggt
gctgtcgttgattcgtggtgcggagacaactgttgccccggaagaaaatacaaagactat
ttcaacttctcacatcctttgatctcatcaaacttagttcaagaagactgtgcttggctt
tctggtatgaatgtctttgatctcaaagcctggagacaaaccaatattactgaagcttac
tctacatggctaagactcagtgttaggtcaggactacaattatggcaaccaggggcttta
ccaccgacattacttgctttcaaaggacttacacagtctcttgaaccatcatggcacgtc
gctggactaggttctcgatccgtaaaatcccctcaagagattctgaaatctgcttcggtt
ttacatttcagcggtccagcaaaaccgtggctagagatcagtaaccctgaggtacgatct
ctttggtatagatacgtaaattcctccgacatcttcgttagaaaatgcaaaatcatgaac
tga

DBGET integrated database retrieval system