KEGG   Arabidopsis thaliana (thale cress): AT4G26410Help
Entry
AT4G26410         CDS       T00041                                 

Definition
(RefSeq) chromosome-associated kinesin
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF883 Laminin_I Clr2_transil CLZ zf-C4H2
Motif
Other DBs
NCBI-GeneID: 828747
NCBI-ProteinID: NP_194371
MIPS: AT4G26410.1
TAIR: AT4G26410
Araport: AT4G26410
UniProt: Q84K90 A0A178V3B3
Position
4
AA seq 263 aa AA seqDB search
MSETEATGVTDDSAPAIETETVSDAMEHTAIGVVESVEGAIEGAEKWVGDLQRTVKESKD
TAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYAKEHPAAAIGIG
VAASLVLMRGPRRFLFRNTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLERTAL
AEKDMKRGLSELMNSGNDIHRLAKSVHKAECEAADLMDGLRQIPGRDAIKLRAEVASMTS
LLRQKRIALNKRIMGMSDLGVSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgaagcaaccggcgttaccgatgattcggctccagcgattgagactgaa
actgtttctgatgcgatggagcatacagcgatcggagtggttgaatcggtggaaggagcc
atagaaggagcagagaaatgggtgggtgatttgcaacggacggtgaaggaatcgaaggat
accgcaatgcgttctgctcgttccctccgtgaaaattctacctctcagttccgctctata
caggatttcattccacatgctttgactcagtataagacctatgagaatgctttcttcagt
aaagttacagacgaattgatatacgcaaaagagcatccggctgctgctattgggattggt
gtcgctgctagtctcgttctgatgcgaggcccaagaagattcttgtttcgtaatacacta
ggccgatttcagagcgaagaggcacaattcttgaaagctgagaagcatgttcaggagtta
aacatgtctgtagacttgatgaaaaaggagagcaggaaattgcttgagaggacggcttta
gcagagaaggatatgaaacgtggtctctctgagctcatgaactctggaaacgatatacat
cgtcttgctaagtccgtccacaaagctgaatgtgaagctgctgatttgatggacggactt
cggcaaattcctggaagggatgctatcaagcttagagctgaagtggcttccatgacttcg
cttttgagacagaagaggattgcattgaacaaaaggatcatgggtatgtcggacctagga
gtttccgtctga

DBGET integrated database retrieval system