KEGG   Arabidopsis thaliana (thale cress): AT4G39750Help
Entry
AT4G39750         CDS       T00041                                 

Definition
(RefSeq) F-box family protein-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: F-box
Motif
Other DBs
NCBI-GeneID: 830131
NCBI-ProteinID: NP_568069
MIPS: AT4G39750.1
TAIR: AT4G39750
Araport: AT4G39750
UniProt: Q3E9N2
Position
4
AA seq 146 aa AA seqDB search
MSSEVEPPQKKKQPWLPDYIVENCLAHISRSYYPKLSLVSSPFALSSYPKSSTKRDIAST
TEEYFFHVCLQLPKSPLPTWYTLWIKPDQIEKKKKINTFTGNTRLVQIPSSYHYPFDQVF
IFNLYGAMRSSKAMVRPPSYGLVSMF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgaagtcgaaccaccgcagaaaaagaagcagccgtggcttccagattatatc
gttgagaactgtttagcacacatatcgagatcttactacccgaaactctccctagtctca
agtcctttcgctctctcgtcgtatccaaagagctcaacaaagcgcgatatcgcctcaaca
accgaagaatacttcttccacgtctgcttacagcttcctaagagtcctcttccaacctgg
tacacgctctggataaaacctgatcagatcgagaagaagaagaagattaatacgtttact
ggaaatactcggttggtacaaataccatcttcctatcattatccttttgaccaagtgttc
atctttaatctttatggtgctatgcgttcatccaaggcaatggtccgtcccccttcatat
gggttggtaagcatgttttga

DBGET integrated database retrieval system