KEGG   Arabidopsis thaliana (thale cress): AT4G39753Help
Entry
AT4G39753         CDS       T00041                                 

Definition
(RefSeq) Galactose oxidase/kelch repeat superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 F-box Kelch_2 Kelch_6 Kelch_4
Motif
Other DBs
NCBI-GeneID: 830132
NCBI-ProteinID: NP_568070
MIPS: AT4G39753.1
TAIR: AT4G39753
Araport: AT4G39753
UniProt: Q1PE09
Position
4
AA seq 390 aa AA seqDB search
MVTFWAETAASAATTSKGEPPSKKRKTNPSPPPSLLSLPDVLILNCLSRIPKSYYPKLSI
VSKTFRDLIISIDLNHARFHHKTQEHFFHVCLKLPDRPLPSWYTLWIKPQGFDDKEEEKK
KKKKSTLVQVPSSYASQTPLLVVGIDSDVYAFKQCYPPSRVMFVRNKECVIWRNAPDMTV
ARANPVAYVFDRKIYVMGGCAETESANWGEVFDPKTQTWEPLPVPSPELRFSSMIRKIEM
IQGKFYVRSNDSKDSVYDPIREKWNVAAKPQLNDSRCSVGNVWYSCRPNSFLWFDNEIKN
WRLIKGLSSLNHSCRSGLIETVCYDGNLLLLWDKPTKPRRRVCEDKYICCALISFNKRKN
GQVWGKVEWSNVVLTVPSSYRFLRSTVIRT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtcactttttgggcagaaaccgccgcctctgcggctacgacttccaaaggcgaacca
ccgtcgaaaaagaggaaaacgaatccatctcctcctccgtcgcttttgtcactcccagat
gttctcattctaaactgtttatcccgtataccgaaatcgtattaccctaaactctccata
gtctccaaaacatttcgtgatctcatcatatccattgatcttaaccacgctcgatttcac
cacaaaacacaagaacacttttttcatgtctgcttaaagcttcccgatcgtcctcttccc
tcgtggtacacactctggatcaaaccccaaggattcgatgacaaggaggaggagaagaag
aagaagaagaagtctaccttggtacaagtaccttcttcctatgcttctcaaacaccattg
ctcgtagtaggtattgattcagatgtctatgcattcaaacaatgttatcctccctctcgg
gtcatgtttgttcgtaacaaggagtgtgtcatatggcgtaatgcccccgacatgactgtg
gctagagctaatcctgttgcctacgtcttcgataggaaaatatatgttatgggaggttgt
gcggaaaccgaatccgcaaattggggtgaggtttttgatccaaagactcaaacttgggaa
cctttacctgtcccttcccctgagctccgcttctcttcaatgattagaaaaatagagatg
atccaaggaaagttttacgtgaggagcaatgacagcaaggactctgtttatgatccgata
agagagaaatggaacgttgcagcgaaaccgcagttgaatgatagtaggtgttcggtaggt
aatgtttggtactcttgtcgtcccaacagtttcttgtggtttgacaatgaaattaaaaat
tggagactgatcaagggtttgtcttcgttgaatcatagttgtcgtagtggtttgattgaa
acagtttgctacgatgggaatctcttactattgtgggacaagcctaccaagcctcgccgt
cgtgtttgtgaagacaagtatatttgctgtgcgttgatttcgtttaataagcgcaaaaat
ggtcaagtttggggtaaggttgagtggtctaatgttgtgcttacggttcccagttcatac
cgtttcttgcgttctacagtgatacggacttga

DBGET integrated database retrieval system